Recombinant Human NRK1 His Protein

SDS-Page: Recombinant Human MID2 Protein [NBP1-98958] - 3ug by SDS-PAGE under reducing condition and visualized by coomassie blue stain.

• Reactivity: Hu
• Applications: PAGE
• Concentration: 0.5 mg/ml

Recombinant Human NRK1 His Protein Summary

• Description: A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-199 of Human NRK1
  
  Source: E.coli
  
  Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMGS>MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA
• Source: E. coli
• Protein/Peptide Type: Recombinant Protein
• Gene: NMRK1
• Purity: >90%, by SDS-PAGE

Applications/Dilutions

• Dilutions:
  • SDS-Page
• Theoretical MW: 25.6 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: Phosphate-Buffered Saline (pH 7.4), 10% Glycerol
• Preservative: No Preservative
• Concentration: 0.5 mg/ml
• Purity: >90%, by SDS-PAGE

Alternate Names for Recombinant Human NRK1 His Protein

• bA235O14.2
• C9orf95
• cDNA FLJ39825
• EC 2.7.1.173
• EC 2.7.1.22
• EC 2.7.1.n4
• FLJ20559
• nicotinamide riboside kinase 1
• Nicotinic acid riboside kinase 1
• NmR-K 1
• NMRK1
• NRK 1
• NRK1
• Ribosylnicotinamide kinase 1
• Ribosylnicotinic acid kinase 1
• RNK 1

Background

Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: NMRK1