NRAMP2/SLC11A2/DMT1 Antibody

Images

 
Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-91840] - Staining of human pancreas shows strong cytoplasmic and membranous positivity in pancreatic ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NRAMP2/SLC11A2/DMT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QCLIALGMSFLDCGHTCHLGLTAQPELYLLNTMDADSLVSR
Specificity
Specificity of human NRAMP2/SLC11A2/DMT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC11A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID: 30171894).
Control Peptide
NRAMP2/SLC11A2/DMT1 Protein (NBP1-91840PEP)
Publications
Read Publication using
NBP1-91840 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30171894). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NRAMP2/SLC11A2/DMT1 Antibody

  • DCT1
  • DCT1NRAMP 2
  • Divalent cation transporter 1
  • Divalent metal transporter 1
  • DMT-1
  • DMT1FLJ37416
  • member 2
  • NRAMP2
  • NRAMP2natural resistance-associated macrophage protein 2
  • SLC11A2
  • solute carrier family 11 (proton-coupled divalent metal ion transporters)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-21502
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB300-914
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-59337
Species: Hu, Mu, Bv
Applications: WB, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-85483
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-79843
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, CyTOF-ready
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-60616
Species: Hu
NBP2-59376
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-91840
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840) (0)

There are no reviews for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840). (Showing 1 - 1 of 1 FAQ).

  1. Do you have a primary anti-DMT1 antibody against mouse for Western Blot?
    • We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NRAMP2/SLC11A2/DMT1 Products

Bioinformatics Tool for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840)

Discover related pathways, diseases and genes to NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840)

Discover more about diseases related to NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840).
 

Pathways for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840)

View related products by pathway.

PTMs for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840)

Learn more about PTMs related to NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840).

Blogs on NRAMP2/SLC11A2/DMT1

There are no specific blogs for NRAMP2/SLC11A2/DMT1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRAMP2/SLC11A2/DMT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC11A2