NRAMP2/SLC11A2/DMT1 Antibody

Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody [NBP1-91840] - Staining of human pancreas shows strong cytoplasmic and membranous positivity in pancreatic ducts.

Product Discontinued

NRAMP2/SLC11A2/DMT1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QCLIALGMSFLDCGHTCHLGLTAQPELYLLNTMDADSLVSR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC11A2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot -Reported in scientific literature (PMID: 30171894).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30171894). Immunogen displays the following percentage of sequence identity for non-tested species: Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NRAMP2/SLC11A2/DMT1 Antibody

• DCT1
• DCT1NRAMP 2
• Divalent cation transporter 1
• Divalent metal transporter 1
• DMT-1
• DMT1FLJ37416
• member 2
• NRAMP2
• NRAMP2natural resistance-associated macrophage protein 2
• SLC11A2
• solute carrier family 11 (proton-coupled divalent metal ion transporters)

Background

The SLC11A2 gene encodes a divalent metal transporter (DMT1), which carries iron, manganese, cobalt, nickel, cadmium, lead, copper, and zinc. DMT1 participates in cellular iron absorption at the luminal surface of the duodenum as well as in other areas of the body (Hubert and Hentze, 2002 [PubMed 12209011]; Ludwiczek et al., 2007 [PubMed 17293870]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840)(2)

Publications using NBP1-91840

• Wang X, Wang Z, Cao J Et Al. Melatonin Alleviates Acute Sleep Deprivation-Induced Memory Loss in Mice by Suppressing Hippocampal Ferroptosis Frontiers in Pharmacology 2021-07-16 [PMID: 34335271] (WB)
• Zhang Q, Li C, Zhang T et al. Deletion of Kir6.2/SUR1 potassium channels rescues diminishing of DA neurons via decreasing iron accumulation in PD Molecular and Cellular Neuroscience 2018-08-01 [PMID: 30171894] (WB, Mouse)

FAQs for NRAMP2/SLC11A2/DMT1 Antibody (NBP1-91840). (Showing 1 - 1 of 1 FAQs).

1. Do you have a primary anti-DMT1 antibody against mouse for Western Blot?
   • We do not currently have any antibodies that we have tested against mouse for DMT1. However, if you would try one of our DMT1 antibodies against mouse, we do have an <a href="http://www.novusbio.com/support/innovators-reward.html" target="_self">Innovators Reward Program</a>.

Bioinformatics

• Gene Symbol: SLC11A2