non-muscle heavy chain 10 Myosin Recombinant Protein Antigen

Images

 
There are currently no images for non-muscle heavy chain 10 Myosin Protein (NBP2-38566PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

non-muscle heavy chain 10 Myosin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYH10.

Source: E. coli

Amino Acid Sequence: RQLDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYH10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38566.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for non-muscle heavy chain 10 Myosin Recombinant Protein Antigen

  • cellular myosin heavy chain, type B type B
  • Cellular myosin heavy chain, type B
  • heavy polypeptide 10, non-muscle
  • MGC134913
  • MGC134914
  • MYH10
  • Myosin heavy chain 10
  • Myosin heavy chain, non-muscle IIb
  • myosin heavy chain, nonmuscle type B
  • myosin, heavy chain 10, non-muscle
  • myosin-10
  • near to the ATP binding region
  • NMMHC II-b
  • NMMHCB
  • NMMHC-B
  • NMMHC-IIB
  • non-muscle heavy chain 10 Myosin
  • Non-muscle myosin heavy chain B
  • nonmuscle myosin heavy chain IIB
  • Non-muscle myosin heavy chain IIb
  • nonmuscle myosin heavy chain-B
  • nonmuscle myosin II heavy chain-B

Background

Myosin II is a hexameric protein that consist of a pair of heavy chain subunits (MHC), a pair of essential light chain subunits (MLC), and a pair of regulatory light chain subunits (RLCs). Non-muscle myosin heavy chain II-B is encoded by the myosin heavy chain 10 gene (MYH10) and non-muscle myosin heavy chain II-A is encoded by the Myosin heavy chain 9 gene (MYH9). Myosin in non-muscle cells is involved in motile cellular processes which include cytokinesis, cell shape, secrection, and capping. Alternate names for Myosin-10 is Myosin heavy chain II-B, cellular myosin heavy chain type B, and NMMHCB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004627-M03
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NBP2-33434
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87748
Species: Hu
Applications: ICC/IF, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-15669
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
NBP2-67899
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-26616
Species: Hu
Applications: IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF7865
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-32974
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-94624
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-86267
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-94899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-38566PEP
Species: Hu
Applications: AC

Publications for non-muscle heavy chain 10 Myosin Protein (NBP2-38566PEP) (0)

There are no publications for non-muscle heavy chain 10 Myosin Protein (NBP2-38566PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for non-muscle heavy chain 10 Myosin Protein (NBP2-38566PEP) (0)

There are no reviews for non-muscle heavy chain 10 Myosin Protein (NBP2-38566PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for non-muscle heavy chain 10 Myosin Protein (NBP2-38566PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional non-muscle heavy chain 10 Myosin Products

Blogs on non-muscle heavy chain 10 Myosin

There are no specific blogs for non-muscle heavy chain 10 Myosin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our non-muscle heavy chain 10 Myosin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYH10