NMNAT3 Antibody (NBP2-55011)

Images

 
Immunocytochemistry/ Immunofluorescence: NMNAT3 Antibody [NBP2-55011] - Staining of human cell line U-2 OS shows localization to mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NMNAT3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARLALQTSDWIR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NMNAT3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NMNAT3 Recombinant Protein Antigen (NBP2-55011PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NMNAT3 Antibody

  • EC 2.7.7.1
  • EC 2.7.7.18
  • NaMN adenylyltransferase 3
  • nicotinamide mononucleotide adenylyltransferase 3
  • nicotinamide nucleotide adenylyltransferase 3
  • Nicotinate-nucleotide adenylyltransferase 3
  • PNAT-3
  • PNAT3NMN adenylyltransferase 3
  • Pyridine nucleotide adenylyltransferase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00064802-B01P
Species: Hu, Ha
Applications: WB, ELISA, ICC/IF
H00023057-M02
Species: Hu
Applications: WB, ELISA
NBP1-87243
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP1-86057
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF5480
Species: Hu
Applications: IHC
NB100-2412
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00006938-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-38640
Species: Hu
Applications: IHC, IHC-P
NBP2-13285
Species: Hu
Applications: IHC, IHC-P
NBP2-55973
Species: Hu
Applications: WB, ICC/IF
NBP1-81214
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NMNAT3 Antibody (NBP2-55011) (0)

There are no publications for NMNAT3 Antibody (NBP2-55011).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NMNAT3 Antibody (NBP2-55011) (0)

There are no reviews for NMNAT3 Antibody (NBP2-55011). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NMNAT3 Antibody (NBP2-55011) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NMNAT3 Products

Related Products by Gene

Bioinformatics Tool for NMNAT3 Antibody (NBP2-55011)

Discover related pathways, diseases and genes to NMNAT3 Antibody (NBP2-55011). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NMNAT3 Antibody (NBP2-55011)

Discover more about diseases related to NMNAT3 Antibody (NBP2-55011).
 

Pathways for NMNAT3 Antibody (NBP2-55011)

View related products by pathway.

PTMs for NMNAT3 Antibody (NBP2-55011)

Learn more about PTMs related to NMNAT3 Antibody (NBP2-55011).

Blogs on NMNAT3

There are no specific blogs for NMNAT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NMNAT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NMNAT3