Recombinant Human Nicotinic Acetylcholine Receptor epsilon Protein Summary
| Description |
A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-110 of Human CHRNE partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLV |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
CHRNE |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Nicotinic Acetylcholine Receptor epsilon Protein
Background
CHRNE - cholinergic receptor, nicotinic, epsilon polypeptide
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Rt
Applications: BA, BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Am, Ch, Fi, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ICC/IF
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Publications for Nicotinic Acetylcholine Receptor epsilon Partial Recombinant Protein (H00001145-Q01) (0)
There are no publications for Nicotinic Acetylcholine Receptor epsilon Partial Recombinant Protein (H00001145-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Nicotinic Acetylcholine Receptor epsilon Partial Recombinant Protein (H00001145-Q01) (0)
There are no reviews for Nicotinic Acetylcholine Receptor epsilon Partial Recombinant Protein (H00001145-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Nicotinic Acetylcholine Receptor epsilon Partial Recombinant Protein (H00001145-Q01). (Showing 1 - 1 of 1 FAQ).
-
I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
- A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.
Additional Nicotinic Acetylcholine Receptor epsilon Products
Research Areas for Nicotinic Acetylcholine Receptor epsilon Partial Recombinant Protein (H00001145-Q01)
Find related products by research area.
|
Blogs on Nicotinic Acetylcholine Receptor epsilon