Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein

SDS-Page: Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein [H00001139-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue

• Reactivity: Hu
• Applications: WB, ELISA, MA, PAGE, AP

Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 182-502 of Human CHRNA7
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLSLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMITVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: CHRNA7
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Theoretical MW: 61.05 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nicotinic Acetylcholine R alpha 7/CHRNA7 Protein

• a7 nicotinic acetylcholine receptor
• alpha 7 neuronal nicotinic acetylcholine receptor
• alpha-7 nicotinic cholinergic receptor subunit
• cholinergic receptor, nicotinic, alpha 7
• cholinergic receptor, nicotinic, alpha polypeptide 7
• CHRNA7
• CHRNA7-2
• NACHRA7
• neuronal acetylcholine receptor protein, alpha-7 chain
• neuronal acetylcholine receptor subunit alpha-7
• Nicotinic Acetylcholine R alpha 7
• Nicotinic Acetylcholine Ra 7

Background

CHRNA7( AAH37571, 1 a.a. - 322 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for Nicotinic Acetylcholine R alpha 7/CHRNA7 Full Length Recombinant Protein (H00001139-Q01). (Showing 1 - 2 of 2 FAQ).

1. I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?
   • We currently have three alpha7 nicotinic cholingergic receptor antibodies available for purchase. Please see this list for our Parvalbumin antibodies. None are currently validated in mouse. I would like to introduce you to our Innovators Reward Program. We have an excelent calbinin D28K antibody that has been validated for use in human and mouse and WB. The pricing and availability of our products depends on your country.
2. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
   • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Bioinformatics

• Gene Symbol: CHRNA7