Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Nicotinic Acetylcholine R alpha 6/CHRNA6. Peptide sequence: MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIR The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CHRNA6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free
Background
Nicotinic acetylcholine receptors (nAChRs, AChRs) are protein complexes made up of protein subunits that coassemble to form an ion channel. This ion channel is gated through the binding of the neurotransmitter acetylcholine (ACh) to its ligand-binding site on the AChR. After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. CHRNA6 (cholinergic nicotinic receptor alpha polypeptide 6) is a neuronal acetylcholine receptor protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Rt
Applications: ELISA, Flow, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Bv, Ca, Ch, Eq, Hu, Pm, Po
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA, Flow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Bv, Ch, Dr, Eq, Hu, Mu, Po, Rt
Applications: IB, ICC/IF, IHC-FrFl, IHC, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody (NBP2-84180) (0)
There are no publications for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody (NBP2-84180).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody (NBP2-84180) (0)
There are no reviews for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody (NBP2-84180).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody (NBP2-84180) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Nicotinic Acetylcholine R alpha 6/CHRNA6 Products
Research Areas for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody (NBP2-84180)
Find related products by research area.
|
Blogs on Nicotinic Acetylcholine R alpha 6/CHRNA6