Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

Western Blot: Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody [NBP2-84180] - WB Suggested Anti-CHRNA6 Antibody. Titration: 1.0 ug/ml. Positive Control: Jurkat Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Nicotinic Acetylcholine R alpha 6/CHRNA6. Peptide sequence: MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHRNA6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Nicotinic Acetylcholine R alpha 6/CHRNA6 Antibody - BSA Free

• CHNRA6
• cholinergic receptor, nicotinic, alpha 6
• cholinergic receptor, nicotinic, alpha polypeptide 6
• CHRNA6
• neuronal acetylcholine receptor subunit alpha-6
• Nicotinic Acetylcholine R alpha 6
• Nicotinic Acetylcholine Ra6

Background

Nicotinic acetylcholine receptors (nAChRs, AChRs) are protein complexes made up of protein subunits that coassemble to form an ion channel. This ion channel is gated through the binding of the neurotransmitter acetylcholine (ACh) to its ligand-binding site on the AChR. After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. CHRNA6 (cholinergic nicotinic receptor alpha polypeptide 6) is a neuronal acetylcholine receptor protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CHRNA6