Neurochondrin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Neurochondrin Antibody [NBP1-87901] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Neurochondrin Antibody [NBP1-87901] - Analysis in human cerebral cortex and liver tissues using NBP1-87901 antibody. Corresponding NCDN RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Neurochondrin Antibody [NBP1-87901] - Staining of human Liver shows no cytoplasmic positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Neurochondrin Antibody [NBP1-87901] - Staining of human Cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Immunohistochemistry-Paraffin: Neurochondrin Antibody [NBP1-87901] - Staining of human Cerebellum shows moderate cytoplasmic positivity in Purkinje cells.

Immunohistochemistry-Paraffin: Neurochondrin Antibody [NBP1-87901] - Staining of human Pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected.

Analysis in human cerebral cortex tissue.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Neurochondrin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Neurochondrin Antibody - BSA Free (NBP1-87901) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Neurochondrin Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PEYEGIWADLQELWFLGMQAFTGCVPLLPWLAPAALRSRWPQELLQLLGSVSPNSVKPEMVAAYQGVLVELARANRLCREAMRLQAGEETASHYRMAA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCDN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 1:100-1:500
• Application Notes: WB, ICC/IF reported in scientific literature (PMID: 23687301). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Neurochondrin Protein (NBP1-87901PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23687301).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Neurochondrin Antibody - BSA Free

• KIAA0607NCDN-1
• NCDN-2
• neurochondrin

Background

Neurochondrin encodes a leucine-rich cytoplasmic protein, which is highly similar to a mouse protein that negatively regulates Ca/calmodulin-dependent protein kinase II phosphorylation and may be essential for spatial learning processes. Several alternatively spliced transcript variants of this gene have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Neurochondrin Antibody (NBP1-87901)(1)

Publication using NBP1-87901

• Oku S, Takahashi N, Fukata Y, Fukata M. In Silico Screening for Palmitoyl Substrates Reveals a Role for DHHC1/3/10 (zDHHC1/3/11)-mediated Neurochondrin Palmitoylation in Its Targeting to Rab5-positive Endosomes. J Biol Chem 2013-07-05 [PMID: 23687301] (WB, ICC/IF, Human)

Bioinformatics

• Gene Symbol: NCDN