Neurobeachin Antibody (3F11) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: Neurobeachin Antibody (3F11) [H00026960-M01] - Analysis of monoclonal antibody to NBEA on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: Neurobeachin Antibody (3F11) [H00026960-M01] - Detection limit for recombinant GST tagged NBEA is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3F11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Neurobeachin Antibody (3F11) - Azide and BSA Free Summary

• Immunogen: NBEA (NP_056493.3, 1133 a.a. ~ 1220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPNIQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSI
• Specificity: This product is specific for Human NBEA monoclonal antibody (M01), clone 3F11 [Gene ID: 26960].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NBEA
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:100-1:2000
• Application Notes: Mouse monoclonal antibody raised against a partial recombinant NBEA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Neurobeachin Antibody (3F11) - Azide and BSA Free

• BCL8Blysosomal trafficking regulator 2
• EC 1.14.14.5
• EC 6.1.1.11
• FLJ10197
• KIAA1544
• Lysosomal-trafficking regulator 2
• LYST2
• neurobeachin
• Protein BCL8B

Background

Neurobeachin binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. It may anchor the kinase to cytoskeletal and/or organelle-associated proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NBEA
• Uniprot:
  • NP_056493.3(Human)