Neurobeachin Antibody (3F11) - Azide and BSA Free Summary
Immunogen |
NBEA (NP_056493.3, 1133 a.a. ~ 1220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ADEKEDLPNSSTSFLFDKIPKQEEKLLPELSSNHIIPNIQDTQVHLGVSDDLGLLAHMTGSVDLTCTSSIIEEKEFKIHTTSDGMSSI |
Specificity |
This product is specific for Human NBEA monoclonal antibody (M01), clone 3F11 [Gene ID: 26960]. |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
NBEA |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA 1:100-1:2000
- Immunocytochemistry/ Immunofluorescence 1:10-1:2000
- Sandwich ELISA 1:100-1:2000
- Western Blot 1:100-1:2000
|
Application Notes |
Mouse monoclonal antibody raised against a partial recombinant NBEA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Neurobeachin Antibody (3F11) - Azide and BSA Free
Background
Neurobeachin binds to type II regulatory subunits of protein kinase A and anchors/targets them to the membrane. It may anchor the kinase to cytoskeletal and/or organelle-associated proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
Species: Hu, Mu, Ze
Applications: WB
Species: Hu
Applications: IB, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC, Simple Western, WB
Publications for Neurobeachin Antibody (H00026960-M01) (0)
There are no publications for Neurobeachin Antibody (H00026960-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neurobeachin Antibody (H00026960-M01) (0)
There are no reviews for Neurobeachin Antibody (H00026960-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Neurobeachin Antibody (H00026960-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Neurobeachin Products
Blogs on Neurobeachin