Neurexin 3/NRXN3 Recombinant Protein Antigen

Images

 
There are currently no images for Neurexin 3/NRXN3 Protein (NBP1-88424PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Neurexin 3/NRXN3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NRXN3.

Source: E. coli

Amino Acid Sequence: LTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDDLVSSAECSSDDEDFVECEPSTANPTEP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NRXN3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88424.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Neurexin 3/NRXN3 Recombinant Protein Antigen

  • C14orf60
  • chromosome 14 open reading frame 60
  • KIAA0743MGC176711
  • Neurexin 3
  • neurexin III
  • Neurexin III-alpha
  • Neurexin III-beta
  • neurexin-3-beta
  • NRXN3

Background

Neurexins are a family of proteins that function in the vertebrate nervous system as cell adhesion molecules and receptors. They are encoded by several unlinked genes of which two, NRXN1 and NRXN3, are among the largest known human genes. Three of the genes (NRXN1-3) utilize two alternate promoters and include numerous alternatively spliced exons to generate thousands of distinct mRNA transcripts and protein isoforms. The majority of transcripts are produced from the upstream promoter and encode alpha-neurexin isoforms; a much smaller number of transcripts are produced from the downstream promoter and encode beta-neurexin isoforms. The alpha-neurexins contain epidermal growth factor-like (EGF-like) sequences and laminin G domains, and have been shown to interact with neurexophilins. The beta-neurexins lack EGF-like sequences and contain fewer laminin G domains than alpha-neurexins. Please note, this product is one of a range of Investigative Grade antibodies, made against targets that have limited or no commercial antibodies available to them and for which there are no data on the expression of the protein in the range of common cell lines and tissues available to us. These antibodies are affinity purified using their peptide immunogen and are known to give low background staining in a western blot. However no additional claims are made for their ability to recognise native protein in any application.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

5268-NX
Species: Hu
Applications: Bind
NBP3-16285
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-41103
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-90080
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP3-38255
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-89063
Species: Hu, Mu
Applications: ChIP-EXO-SEQ, IHC,  IHC-P, WB
6636-NX
Species: Hu
Applications: BA
NBP1-92090
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NBP2-81843
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-41299
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-77122
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DBD00
Species: Hu
Applications: ELISA
AF4340
Species: Hu, Rt
Applications: IHC, WB
NBP1-76997
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
AF5394
Species: Hu, Mu
Applications: WB
NBP1-76998
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-24713
Species: Ca, Hu, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
H00079047-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
AF4076
Species: Mu, Rt
Applications: ICC, Simple Western, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB

Publications for Neurexin 3/NRXN3 Protein (NBP1-88424PEP) (0)

There are no publications for Neurexin 3/NRXN3 Protein (NBP1-88424PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurexin 3/NRXN3 Protein (NBP1-88424PEP) (0)

There are no reviews for Neurexin 3/NRXN3 Protein (NBP1-88424PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Neurexin 3/NRXN3 Protein (NBP1-88424PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurexin 3/NRXN3 Products

Research Areas for Neurexin 3/NRXN3 Protein (NBP1-88424PEP)

Find related products by research area.

Blogs on Neurexin 3/NRXN3

There are no specific blogs for Neurexin 3/NRXN3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Neurexin 3/NRXN3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NRXN3