NDUFV3 Antibody

Images

 
Western Blot: NDUFV3 Antibody [NBP1-85623] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: NDUFV3 Antibody [NBP1-85623] - Staining of human kidney shows strong positivity in cells in tubules and glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFV3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PPLPRKETSGTQGIEGHLKGGQAIVEDQIPPSNLETVPVENNHGFHEKTAALKLEAEGEAMEDAAAPGDDRGGTQEPAPVPAEPFDNTTYKNLQHHDYSTYTFLDLNLELSKFRMP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFV3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFV3 Protein (NBP1-85623PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFV3 Antibody

  • CI-10k
  • CI-9KD
  • complex I 10kDa subunit
  • complex I, mitochondrial respiratory chain, 10-kD subunit
  • Complex I-9kD
  • mitochondrial NADH oxidoreductase-like protein
  • NADH dehydrogenase (ubiquinone) flavoprotein 3 (10kD)
  • NADH dehydrogenase (ubiquinone) flavoprotein 3, 10kDa
  • NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
  • NADH-ubiquinone oxidoreductase 9 kD subunit precursor, EC 1.6.5.310CI-9kD
  • NADH-ubiquinone oxidoreductase 9 kD subunit
  • NADH-ubiquinone oxidoreductase 9 kDa subunit
  • NADH-ubiquinone oxidoreductase flavoprotein 3, 10kD
  • Renal carcinoma antigen NY-REN-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86901
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19853
Species: Hu
Applications: WB, ChIP, ICC/IF, IP
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
NBP1-00641
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-84975
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86687
Species: Hu
Applications: WB, IHC, IHC-P
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NBP1-82648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NBP1-85623
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NDUFV3 Antibody (NBP1-85623) (0)

There are no publications for NDUFV3 Antibody (NBP1-85623).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFV3 Antibody (NBP1-85623) (0)

There are no reviews for NDUFV3 Antibody (NBP1-85623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFV3 Antibody (NBP1-85623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFV3 Products

Bioinformatics Tool for NDUFV3 Antibody (NBP1-85623)

Discover related pathways, diseases and genes to NDUFV3 Antibody (NBP1-85623). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFV3 Antibody (NBP1-85623)

Discover more about diseases related to NDUFV3 Antibody (NBP1-85623).

Blogs on NDUFV3

There are no specific blogs for NDUFV3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFV3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFV3