Recombinant Human NDUFS7 GST (N-Term) Protein

SDS-Page: Recombinant Human NDUFS7 Protein [H00374291-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human NDUFS7 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 213 of Human NDUFS7 full-length ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MAVLSAPGLRGFRILGLRSSVGLAVQARGVHQSVATDGPSSTQPALPKARAVAPKPSSRGEYVVAKLDDLVNWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Full Length Recombinant Protein
• Gene: NDUFS7
• Purity: >10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NDUFS7 GST (N-Term) Protein

• CI-20
• CI-20kD
• complex I, mitochondrial respiratory chain, 20-KD subunit
• Complex I-20kD
• EC 1.6.5.3
• EC 1.6.99.3
• EC 1.6.99.5
• FLJ45860
• FLJ46880
• MGC120002
• MY017
• NADH dehydrogenase (ubiquinone) Fe-S protein 7 (20kD) (NADH-coenzyme Qreductase)
• NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Qreductase)
• NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
• NADH:ubiquinone oxidoreductase PSST subunit
• NADH-coenzyme Q reductase
• NADH-ubiquinone oxidoreductase 20 kDa subunit
• PSST subunit
• PSSTcomplex I 20kDa subunit

Background

This gene encodes a protein that is a subunit of one of the complexes that forms the mitochondrial respiratory chain. This protein is one of over 40 subunits found in complex I, the nicotinamide adenine dinucleotide (NADH):ubiquinone oxidoreductase. This complex functions in the transfer of electrons from NADH to the respiratory chain, and ubiquinone is believed to be the immediate electron acceptor for the enzyme. Mutations in this gene cause Leigh syndrome due to mitochondrial complex I deficiency, a severe neurological disorder that results in bilaterally symmetrical necrotic lesions in subcortical brain regions. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: NDUFS7