Recombinant Human NDUFS7 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NDUFS7 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 114-213 of Human NDUFS7

Source: Wheat Germ

Amino Acid Sequence: PRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYIPGCPPTAEALLYGILQLQRKIKRERRLQIWYRR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NDUFS7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NDUFS7 Protein

  • CI-20
  • CI-20kD
  • complex I, mitochondrial respiratory chain, 20-KD subunit
  • Complex I-20kD
  • EC 1.6.5.3
  • EC 1.6.99.3
  • EC 1.6.99.5
  • FLJ45860
  • FLJ46880
  • MGC120002
  • MY017
  • NADH dehydrogenase (ubiquinone) Fe-S protein 7 (20kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Qreductase)
  • NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
  • NADH:ubiquinone oxidoreductase PSST subunit
  • NADH-coenzyme Q reductase
  • NADH-ubiquinone oxidoreductase 20 kDa subunit
  • PSST subunit
  • PSSTcomplex I 20kDa subunit

Background

NDUFS7 - NADH dehydrogenase (ubiquinone) Fe-S protein 7, 20kDa (NADH-coenzyme Q reductase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85620
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31142
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004723-M01
Species: Hu, Rt
Applications: WB, ELISA, RNAi
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP1-89026
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00004535-Q01
Species: Hu
NBP2-24567
Species: Hu
Applications: WB
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84475
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89559
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NDUFS7 Partial Recombinant Protein (H00374291-Q01) (0)

There are no publications for NDUFS7 Partial Recombinant Protein (H00374291-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFS7 Partial Recombinant Protein (H00374291-Q01) (0)

There are no reviews for NDUFS7 Partial Recombinant Protein (H00374291-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFS7 Partial Recombinant Protein (H00374291-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDUFS7 Products

Bioinformatics Tool for NDUFS7 Partial Recombinant Protein (H00374291-Q01)

Discover related pathways, diseases and genes to NDUFS7 Partial Recombinant Protein (H00374291-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFS7 Partial Recombinant Protein (H00374291-Q01)

Discover more about diseases related to NDUFS7 Partial Recombinant Protein (H00374291-Q01).
 

Pathways for NDUFS7 Partial Recombinant Protein (H00374291-Q01)

View related products by pathway.

PTMs for NDUFS7 Partial Recombinant Protein (H00374291-Q01)

Learn more about PTMs related to NDUFS7 Partial Recombinant Protein (H00374291-Q01).

Blogs on NDUFS7

There are no specific blogs for NDUFS7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NDUFS7 Antibody
NBP1-49846
Sir2.1 Antibody
NB100-1923

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NDUFS7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFS7