NDUFS5 Antibody

Images

 
Western Blot: NDUFS5 Antibody [NBP2-13648] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: NDUFS5 Antibody [NBP2-13648] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFS5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFS5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NDUFS5 Protein (NBP2-13648PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFS5 Antibody

  • CI-15 kDa
  • CI15K
  • CI-15k
  • Complex I-15 kDa
  • NADH dehydrogenase (ubiquinone) Fe-S protein 5 (15kD) (NADH-coenzyme Qreductase)
  • NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Qreductase)
  • NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
  • NADH:ubiquinone oxidoreductase 15 kDa IP subunit
  • NADH-ubiquinone oxidoreductase 15 kDa subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00374291-P01
Species: Hu
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88938
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00000533-R02
Species: Hu
NBP2-55232
Species: Hu
Applications: WB, ICC/IF
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-84475
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-26161
Species: Hu, Mu, Rt, Po
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-82662
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03498
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for NDUFS5 Antibody (NBP2-13648) (0)

There are no publications for NDUFS5 Antibody (NBP2-13648).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFS5 Antibody (NBP2-13648) (0)

There are no reviews for NDUFS5 Antibody (NBP2-13648). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFS5 Antibody (NBP2-13648) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NDUFS5 Products

Bioinformatics Tool for NDUFS5 Antibody (NBP2-13648)

Discover related pathways, diseases and genes to NDUFS5 Antibody (NBP2-13648). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFS5 Antibody (NBP2-13648)

Discover more about diseases related to NDUFS5 Antibody (NBP2-13648).
 

Pathways for NDUFS5 Antibody (NBP2-13648)

View related products by pathway.

PTMs for NDUFS5 Antibody (NBP2-13648)

Learn more about PTMs related to NDUFS5 Antibody (NBP2-13648).

Blogs on NDUFS5

There are no specific blogs for NDUFS5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFS5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFS5