NDUFAF5 Antibody

Images

 
Western Blot: NDUFAF5 Antibody [NBP2-87893] - Host: Rabbit. Target Name: NDUFAF5. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Hu, Rt, Po, Bv, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NDUFAF5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUFAF5. Peptide sequence: TLNIFDRDLKRKQKNWAARQPEPTKFDYLKEEVGSRIADRVYDIPRNFPL The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (93%), Porcine (93%), Bovine (93%), Rabbit (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFAF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NDUFAF5 Antibody

  • bA526K24.2
  • C20orf7
  • chromosome 20 open reading frame 7
  • dJ842G6.1
  • EC 2.1.1
  • EC 2.1.1.-
  • FLJ22324
  • MGC90272
  • NADH dehydrogenase (ubiquinone) complex I, assembly factor 5
  • probable methyltransferase C20orf7, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27464
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-80468
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-14585
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83180
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47359
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-94462
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89382
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-93366
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-91858
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27177
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP, KO
H00004704-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-93264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-75587
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46127
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-87893
Species: Hu, Rt, Po, Bv, Rb
Applications: WB

Publications for NDUFAF5 Antibody (NBP2-87893) (0)

There are no publications for NDUFAF5 Antibody (NBP2-87893).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFAF5 Antibody (NBP2-87893) (0)

There are no reviews for NDUFAF5 Antibody (NBP2-87893). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFAF5 Antibody (NBP2-87893) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NDUFAF5 Products

Bioinformatics Tool for NDUFAF5 Antibody (NBP2-87893)

Discover related pathways, diseases and genes to NDUFAF5 Antibody (NBP2-87893). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NDUFAF5 Antibody (NBP2-87893)

Discover more about diseases related to NDUFAF5 Antibody (NBP2-87893).
 

Pathways for NDUFAF5 Antibody (NBP2-87893)

View related products by pathway.

PTMs for NDUFAF5 Antibody (NBP2-87893)

Learn more about PTMs related to NDUFAF5 Antibody (NBP2-87893).

Blogs on NDUFAF5

There are no specific blogs for NDUFAF5, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NDUFAF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFAF5