NCKAP1 Antibody


Western Blot: NCKAP1 Antibody [NBP1-83269] - Analysis in control (vector only transfected HEK293T lysate) and nCKAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T more
Immunocytochemistry/ Immunofluorescence: NCKAP1 Antibody [NBP1-83269] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining in human cerebral cortex and skeletal muscle tissues using anti-NCKAP1 antibody. Corresponding NCKAP1 RNA-seq data are more
Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: NCKAP1 Antibody [NBP1-83269] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

NCKAP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEY
Specificity of human NCKAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NCKAP1 Protein (NBP1-83269PEP)
Read Publication using
NBP1-83269 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NCKAP1 Antibody

  • FLJ11291
  • HEM2p125Nap1
  • KIAA0587
  • Membrane-associated protein HEM-2
  • MGC8981
  • NAP 1
  • NAP125
  • NAP1Nap1
  • NCK-associated protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ELISA, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
Species: Hu
Species: Hu
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for NCKAP1 Antibody (NBP1-83269)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for NCKAP1 Antibody (NBP1-83269) (0)

There are no reviews for NCKAP1 Antibody (NBP1-83269). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NCKAP1 Antibody (NBP1-83269) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for NCKAP1 Antibody (NBP1-83269)

Discover related pathways, diseases and genes to NCKAP1 Antibody (NBP1-83269). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NCKAP1 Antibody (NBP1-83269)

Discover more about diseases related to NCKAP1 Antibody (NBP1-83269).

Pathways for NCKAP1 Antibody (NBP1-83269)

View related products by pathway.

Research Areas for NCKAP1 Antibody (NBP1-83269)

Find related products by research area.

Blogs on NCKAP1

There are no specific blogs for NCKAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NCKAP1 Antibody and receive a gift card or discount.


Gene Symbol NCKAP1