Nav1.7 Antibody (5A11) - Azide and BSA Free

Western Blot: Nav1.7 Antibody (5A11) [H00006335-M01] - detection against Immunogen (33.92 KDa) .

Western Blot: Nav1.7 Antibody (5A11) [H00006335-M01] - SCN9A monoclonal antibody (M01), clone 5A11. Analysis of SCN9A expression in rat testis.

• Reactivity: Hu, Rt
• Applications: WB, ELISA
• Clone: 5A11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Nav1.7 Antibody (5A11) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SCN9A (NP_002968, 269 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY
• Specificity: SCN9A (5A11)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SCN9A
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nav1.7 Antibody (5A11) - Azide and BSA Free

• ETHA
• FEB3B
• hNE-Na
• Nav1.7
• NENA
• NE-NA
• NENAVoltage-gated sodium channel subunit alpha Nav1.7
• Neuroendocrine sodium channel
• Peripheral sodium channel 1
• PN1
• PN1hNE-Na
• SCN9A
• sodium channel protein type 9 subunit alpha
• Sodium channel protein type IX subunit alpha
• sodium channel, voltage-gated, type IX, alpha subunit
• voltage-gated sodium channel alpha subunit Nav1.7
• voltage-gated, type IX, alpha polypeptide

Background

Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-sensitive Na(+) channel isoform. Plays a role in pain mechanisms, especially in the development of inflammatory pain (from SwissProt).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Nav1.7 Antibody (H00006335-M01)(1)

Publication using H00006335-M01

• Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01

Bioinformatics

• Gene Symbol: SCN9A
• Entrez:
  • 6335(Human)
• OMIM:
  • 133020(Human)
• Uniprot:
  • NP_002968(Human)