We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Nardilysin Recombinant Protein Antigen

Images

 
There are currently no images for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Nardilysin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nardilysin.

Source: E. coli

Amino Acid Sequence: LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NRDC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58484.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Nardilysin Recombinant Protein Antigen

  • EC 3.4.24
  • EC 3.4.24.61
  • hNRD1
  • hNRD2
  • nardilysin (N-arginine dibasic convertase)
  • nardilysin
  • N-arginine dibasic convertase
  • NRD convertase
  • NRD-C

Background

NRD1, also known as Nardilysin, has 2 isoforms, a 1,150 amino acid isoform1 that is 132 kDa and a 1,218 amino acid isoform2 that is 139 kDa, primarily found in adult heart, skeletal muscle, and testis, it is a member of the peptidase M16 family, and slices peptide substrates at the N-terminus of arginine residues in dibasic moieties. Disease research is being performed in relation to NRD1 and differentiating neuroblastoma, Down syndrome, Alzheimer's disease, neuroblastoma, prostatitis, neuronitis, and alcoholism. Interactions with NRD1 protein have been shown to involve TP53, HBEGF, CALCA, MYC, FBXW11, and more than 50 other proteins in proteolysis, neuromuscular junction development, cell proliferation, cell migration, and positive regulation of membrane protein ectodomain proteolysis processes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Ch, Hu
Applications: IHC,  IHC-P, IP, KD, WB
2496-ZN
Species: Hu
Applications: EnzAct
NBP1-81838
Species: Hu
Applications: IHC,  IHC-P, WB
943-D3
Species: Hu
Applications: Bind
NBP2-12787
Species: Hu
Applications: IP, WB
NBP3-47457
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
AF4629
Species: Hu
Applications: WB
NBP3-07536
Species: Hu
Applications: Flow, ICC/IF, PA, WB
930-ADB
Species: Hu
Applications: EnzAct
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P
236-EG
Species: Hu
Applications: BA
NBP1-88097
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF-259-NA
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NBP2-49591
Species: Hu
Applications: IHC,  IHC-P
1726-JG
Species: Hu
Applications: BA
NB600-534
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, In vivo, RIA, WB

Publications for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP) (0)

There are no publications for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP) (0)

There are no reviews for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nardilysin Products

Research Areas for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP)

Find related products by research area.

Blogs on Nardilysin

There are no specific blogs for Nardilysin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nardilysin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NRDC