Nardilysin Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Nardilysin. Source: E. coli Amino Acid Sequence: LVNWFKAHRGPGSKMLSVHVVGYGKYELEEDGTPSSEDSNSSCEVMQLTYLPTSPLLADCIIPITDIRAFT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
NRDC |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58484. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Nardilysin Recombinant Protein Antigen
Background
NRD1, also known as Nardilysin, has 2 isoforms, a 1,150 amino acid isoform1 that is 132 kDa and a 1,218 amino acid isoform2 that is 139 kDa, primarily found in adult heart, skeletal muscle, and testis, it is a member of the peptidase M16 family, and slices peptide substrates at the N-terminus of arginine residues in dibasic moieties. Disease research is being performed in relation to NRD1 and differentiating neuroblastoma, Down syndrome, Alzheimer's disease, neuroblastoma, prostatitis, neuronitis, and alcoholism. Interactions with NRD1 protein have been shown to involve TP53, HBEGF, CALCA, MYC, FBXW11, and more than 50 other proteins in proteolysis, neuromuscular junction development, cell proliferation, cell migration, and positive regulation of membrane protein ectodomain proteolysis processes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, PA, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Po, V-Vi
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB
Publications for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP) (0)
There are no publications for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP) (0)
There are no reviews for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP) (0)
Additional Nardilysin Products
Research Areas for Nardilysin Recombinant Protein Antigen (NBP2-58484PEP)
Find related products by research area.
|
Blogs on Nardilysin