Myosin 1E Antibody (7A5) - Azide and BSA Free

Western Blot: Myosin 1E Antibody (7A5) [H00004643-M02-100ug] - Detection against Immunogen (36.41 KDa) .

Western Blot: Myosin 1E Antibody (7A5) [H00004643-M02-100ug] - Analysis of MYO1E expression in transfected 293T cell line by MYO1E monoclonal antibody (M02), clone 7A5. Lane 1: MYO1E transfected lysate (Predicted MW: 127.1 KDa). Lane 2: Non-transfected lysate

ELISA: Myosin 1E Antibody (7A5) [H00004643-M02-100ug] - Detection limit for recombinant GST tagged MYO1E is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 7A5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Myosin 1E Antibody (7A5) - Azide and BSA Free Summary

• Immunogen: MYO1E (NP_004989.2, 918 a.a. ~ 1014 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VSIGPGLPKNSRPTRRNTTQNTGYSSGTQNANYPVRAAPPPPGYHQNGVIRNQYVPYPHAPGSQRSNQKSLYTSMARPPLPRQQSTSSDRVSQTPES
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MYO1E
• Purity: Protein A or G purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A or G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Myosin 1E Antibody (7A5) - Azide and BSA Free

• HuncM-IC
• MGC104638
• MYO1Cmyosin-IC
• MYO1E variant protein
• myosin IE
• Myosin-Ic
• myosin-Ie

Background

Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MYO1E
• Entrez:
  • 4643(Human)
• OMIM:
  • 601479(Human)
• Uniprot:
  • NP_004989.2(Human)