MYO1G Recombinant Protein Antigen

Images

 
There are currently no images for MYO1G Protein (NBP1-93704PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MYO1G Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYO1G.

Source: E.coli

Amino Acid Sequence: SVHRILAAILHLGNIEFVETEEGGLQKEGLAVAEEALVDHVAELTATPRDLVLRSLLARTVASGGRELIEKGHTAAEASYARDACA

Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYO1G
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-93704.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MYO1G Recombinant Protein Antigen

  • HA2
  • myosin IG
  • myosin-Ig

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005555-P01
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24567
Species: Hu
Applications: WB
NBP2-48588
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-91679
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
H00005554-R02
Species: Hu
NBP1-93704PEP
Species: Hu
Applications: AC

Publications for MYO1G Protein (NBP1-93704PEP) (0)

There are no publications for MYO1G Protein (NBP1-93704PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYO1G Protein (NBP1-93704PEP) (0)

There are no reviews for MYO1G Protein (NBP1-93704PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for MYO1G Protein (NBP1-93704PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYO1G Products

Bioinformatics Tool for MYO1G Protein (NBP1-93704PEP)

Discover related pathways, diseases and genes to MYO1G Protein (NBP1-93704PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MYO1G Protein (NBP1-93704PEP)

Discover more about diseases related to MYO1G Protein (NBP1-93704PEP).
 

Pathways for MYO1G Protein (NBP1-93704PEP)

View related products by pathway.

Blogs on MYO1G

There are no specific blogs for MYO1G, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MYO1G Antibody
NBP1-93704
MYO1G Antibody
NBP1-93704
MYO1G Antibody
NBP1-93704

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MYO1G Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO1G