mut-7 Antibody

Immunocytochemistry/Immunofluorescence: mut-7 Antibody [NBP1-92155] - Staining of human cell line U-2 OS shows localization to actin filaments & focal adhesion sites. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: mut-7 Antibody [NBP1-92155] - Staining of human stomach (upper) shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

mut-7 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FAALDDPLAGLLDMLESCRGQRGEGPSLAAWISHQLQCWLQAQPCPSLAQHSLRLKQLQARVVKVLTESPPSLAAPLASIFQLQDADRSCLLAHVHR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EXD3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  mut-7 Protein (NBP1-92155PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for mut-7 Antibody

• EC 3.1
• exonuclease 3'-5' domain containing 3
• Exonuclease 3'-5' domain-containing protein 3
• FLJ20433
• FLJ30442
• LOC54932
• MGC131904
• MGC74981
• mut-7
• probable exonuclease mut-7 homolog

Background

Chimera RNA interference (chimera RNAi) is process by which small interfering RNA/DNA chimera triggers the destruction of mRNA for the original gene. The discovery work, design, and application of chimera RNAi has been pioneered by Professor Kaoru Saigo and Dr. Kumiko Ui-Tei at the University of Tokyo. Chimera RNAi has many advantages over the conventional siRNAs. First, it has been demonstrated to have reliable knock-down for over 10,000 human genes. Because the human genome is composed of an intricate, genetic network, chimera RNAi's unique design has successfully obviated the off-target effects including microRNA-based influence. Another advantage of the chimera RNAi technology is its effectiveness at low concentrations (0.5nM to 5nM); only mRNA is destroyed so genomic genes are not affected. Finally, having both the sense and anti-sense strands consisting RNA/DNA chimera, it offers much greater compound stability for streamlining in vitro and in vivo assays and applications while minimizing interferon induction and other adverse reactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EXD3