Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8)

Images

 
Western Blot: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576] - Western blot analysis of extracts of various cell lines, using Muscarinic AChR M2 (Muscarinic Acetylcholine Receptor M2/CHRM2) ...read more
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576] - Analysis of paraffin-embedded Human esophageal cancer using Muscarinic AChR M2 (Muscarinic AChR M2 (ACM2)) Rabbit ...read more
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576] - Human tonsil tissue using Muscarinic AChR M2 (ACM2) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure ...read more
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576] - Mouse kidney tissue using Muscarinic AChR M2 (ACM2) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure ...read more
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576] - Mouse testis tissue using Muscarinic AChR M2 (ACM2) Rabbit mAb at a dilution of 1:200 (40x lens). High pressure ...read more
Immunohistochemistry: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [NBP3-16576] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Muscarinic AChR M2 Rabbit mAb at a dilution of ...read more
Immunohistochemistry: Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) [Muscarinic Acetylcholine Receptor M2/CHRM2] - Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Muscarinic ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC
Clone
3T5W8
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Muscarinic Acetylcholine Receptor M2/CHRM2 (P08172). LALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVI
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
CHRM2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunohistochemistry 1:200 - 1:2000
  • Immunohistochemistry-Paraffin 1:200 - 1:2000
  • Western Blot 1:1000 - 1:6000
Theoretical MW
52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8)

  • 7TM receptor
  • cholinergic receptor, muscarinic 2
  • CHRM2
  • FLJ43243
  • HM2
  • mAChR M2
  • MGC120006
  • MGC120007
  • muscarinic acetylcholine receptor M2
  • muscarinic M2 receptor

Background

Acetylcholine receptors (AChRs) mediate synaptic transmission at the neuromuscular junction. The channel-linked AChR that mediates rapid, excitatory actions of acetylcholine is called nicotinic AChR (nAChR) because it can be activated by nicotine. The non-channel linked AChR that medicates the slow actions of acetylcholine, which can be either inhibitory or excitatory, is called muscarinic AChR (mAChR) because it can be activated by muscarine. The mAChRs are present in neurons of the central and peripheral nervous systems, cardiac and smooth muscle and various exocrine glands. There are 5 subtypes (m1-m5) of the receptor that have a tissue specific pattern of expression. The m2 receptor is localized primarily in cardiac tissue and is also expressed at low levels in the hippocampus, cortex, striatum, thalamus, basal forebrain, brainstem, lung, vas deferens and uterus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP3-42326
Species: Mu
Applications: IHC, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, WB
MAB6378
Species: Hu
Applications: CyTOF-ready, Flow, IHC
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NLS418
Species: Hu
Applications: IHC,  IHC-P
MAB8458
Species: Hu
Applications: CyTOF-ready, Flow, ICC
NLS1017
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC,  IHC-P
MAB194
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
NLS2756
Species: Hu, Pm
Applications: ICC, IHC,  IHC-P

Publications for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576) (0)

There are no publications for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576) (0)

There are no reviews for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Muscarinic Acetylcholine Receptor M2/CHRM2 Products

Research Areas for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576)

Find related products by research area.

Blogs on Muscarinic Acetylcholine Receptor M2/CHRM2

There are no specific blogs for Muscarinic Acetylcholine Receptor M2/CHRM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRM2