Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Muscarinic Acetylcholine Receptor M2/CHRM2 (P08172). LALDYVVSNASVMNLLIISFDRYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQFFSNAAVTFGTAIAAFYLPVI |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CHRM2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunohistochemistry 1:200 - 1:2000
- Immunohistochemistry-Paraffin 1:200 - 1:2000
- Western Blot 1:1000 - 1:6000
|
| Theoretical MW |
52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (3T5W8)
Background
Acetylcholine receptors (AChRs) mediate synaptic transmission at the neuromuscular junction. The channel-linked AChR that mediates rapid, excitatory actions of acetylcholine is called nicotinic AChR (nAChR) because it can be activated by nicotine. The non-channel linked AChR that medicates the slow actions of acetylcholine, which can be either inhibitory or excitatory, is called muscarinic AChR (mAChR) because it can be activated by muscarine. The mAChRs are present in neurons of the central and peripheral nervous systems, cardiac and smooth muscle and various exocrine glands. There are 5 subtypes (m1-m5) of the receptor that have a tissue specific pattern of expression. The m2 receptor is localized primarily in cardiac tissue and is also expressed at low levels in the hippocampus, cortex, striatum, thalamus, basal forebrain, brainstem, lung, vas deferens and uterus.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Publications for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576) (0)
There are no publications for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576) (0)
There are no reviews for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Muscarinic Acetylcholine Receptor M2/CHRM2 Products
Research Areas for Muscarinic Acetylcholine Receptor M2/CHRM2 Antibody (NBP3-16576)
Find related products by research area.
|
Blogs on Muscarinic Acetylcholine Receptor M2/CHRM2