Recombinant Human MTRF1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MTRF1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human MTRF1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNRHLCVWLFRHPSLNGYLQCHIQLHSHQFRQIHLDTRLQVFRQNRNCILHLLSKNWSRRYCHQDTKMLWKHKALQKYMENLSKEYQTLEQCLQHIPVNE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MTRF1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MTRF1 Protein

  • mitochondrial translational release factor 1
  • mitochondrial
  • MRF1
  • MRF-1
  • MtRF-1

Background

The protein encoded by this gene was determined by in silico methods to be a mitochondrial protein with similarity to the peptide chain release factors (RFs) discovered in bacteria and yeast. The peptide chain release factors direct the termination of translation in response to the peptide chain termination codons. Initially thought to have a role in the termination of mitochondria protein synthesis, a recent publication found no mitochondrial translation release functionality. Multiple alternatively spliced transcript variants have been suggested by mRNA and EST data; however, their full-length natures are not clear. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31113
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88667
Species: Hu
Applications: IHC, IHC-P
AF5059
Species: Hu
Applications: WB, IHC
NBP2-45434
Species: Hu
Applications: WB, IHC
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1028
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, ICC
MAB8175
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-81021
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-02384
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20210
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81019
Species: Hu
Applications: WB, IHC, IHC-P
NB110-68281
Species: Hu, Mu, Rt, Mk
Applications: ICC/IF (-), WB, Simple Western, ELISA, Flow
NBP2-59411
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
7559-ST
Species: Hu

Publications for MTRF1 Partial Recombinant Protein (H00009617-Q01) (0)

There are no publications for MTRF1 Partial Recombinant Protein (H00009617-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTRF1 Partial Recombinant Protein (H00009617-Q01) (0)

There are no reviews for MTRF1 Partial Recombinant Protein (H00009617-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTRF1 Partial Recombinant Protein (H00009617-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTRF1 Products

Bioinformatics Tool for MTRF1 Partial Recombinant Protein (H00009617-Q01)

Discover related pathways, diseases and genes to MTRF1 Partial Recombinant Protein (H00009617-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTRF1 Partial Recombinant Protein (H00009617-Q01)

Discover more about diseases related to MTRF1 Partial Recombinant Protein (H00009617-Q01).
 

Pathways for MTRF1 Partial Recombinant Protein (H00009617-Q01)

View related products by pathway.

Blogs on MTRF1

There are no specific blogs for MTRF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MTRF1 Antibody
H00009617-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MTRF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTRF1