Recombinant Human MTP18 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MTP18 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-166 of Human MTP18 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MTFP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MTP18 Protein

  • HSPC242
  • Mitochondrial 18 kDa protein
  • mitochondrial fission process 1
  • mitochondrial fission process protein 1
  • mitochondrial protein 18 kDa
  • MTP18mitochondrial fission protein MTP18

Background

MTP18( AAH01608, 1 a.a. - 167 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BC100-494
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
AF8216
Species: Hu, Mu, Rt
Applications: WB
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
NB100-56646
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-02477
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
H00007402-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-51841
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBL1-11569
Species: Hu
NBP2-10888
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
H00051537-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for MTP18 Recombinant Protein (H00051537-P01) (0)

There are no publications for MTP18 Recombinant Protein (H00051537-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTP18 Recombinant Protein (H00051537-P01) (0)

There are no reviews for MTP18 Recombinant Protein (H00051537-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MTP18 Recombinant Protein (H00051537-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTP18 Products

Bioinformatics Tool for MTP18 Recombinant Protein (H00051537-P01)

Discover related pathways, diseases and genes to MTP18 Recombinant Protein (H00051537-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTP18 Recombinant Protein (H00051537-P01)

Discover more about diseases related to MTP18 Recombinant Protein (H00051537-P01).
 

Pathways for MTP18 Recombinant Protein (H00051537-P01)

View related products by pathway.

Research Areas for MTP18 Recombinant Protein (H00051537-P01)

Find related products by research area.

Blogs on MTP18

There are no specific blogs for MTP18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

PINK1 Antibody
BC100-494
MTP18 Antibody
NBP2-57803
DRP1 Antibody
NB110-55288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MTP18 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTFP1