MST3 Recombinant Protein Antigen

Images

 
There are currently no images for MST3 Protein (NBP1-87833PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MST3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK24.

Source: E.coli

Amino Acid Sequence: IDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STK24
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87833.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MST3 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • Mammalian STE20-like protein kinase 3
  • MST-3
  • MST3serine/threonine kinase 24 (Ste20, yeast homolog)
  • serine/threonine kinase 24
  • serine/threonine-protein kinase 24
  • STE20
  • STE20-like kinase 3
  • STE20-like kinase MST3
  • sterile 20-like kinase 3
  • STK3yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31233
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32670
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NB300-815
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00009448-M07
Species: Hu, Bv, Pa
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20401
Species: Hu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00009943-M16
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP1-87737
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Gp, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
H00130497-M10
Species: Hu, Mu
Applications: WB, ELISA, S-ELISA

Publications for MST3 Protein (NBP1-87833PEP) (0)

There are no publications for MST3 Protein (NBP1-87833PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MST3 Protein (NBP1-87833PEP) (0)

There are no reviews for MST3 Protein (NBP1-87833PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MST3 Protein (NBP1-87833PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional MST3 Products

Bioinformatics Tool for MST3 Protein (NBP1-87833PEP)

Discover related pathways, diseases and genes to MST3 Protein (NBP1-87833PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MST3 Protein (NBP1-87833PEP)

Discover more about diseases related to MST3 Protein (NBP1-87833PEP).
 

Pathways for MST3 Protein (NBP1-87833PEP)

View related products by pathway.

PTMs for MST3 Protein (NBP1-87833PEP)

Learn more about PTMs related to MST3 Protein (NBP1-87833PEP).
 

Research Areas for MST3 Protein (NBP1-87833PEP)

Find related products by research area.

Blogs on MST3

There are no specific blogs for MST3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MST3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STK24