MST3 Recombinant Protein Antigen

Images

 
There are currently no images for MST3 Protein (NBP1-87833PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MST3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STK24.

Source: E. coli

Amino Acid Sequence: IDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLENGALQPSDLDRNKMKDIPKRPFS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STK24
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87833.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MST3 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • Mammalian STE20-like protein kinase 3
  • MST-3
  • MST3serine/threonine kinase 24 (Ste20, yeast homolog)
  • serine/threonine kinase 24
  • serine/threonine-protein kinase 24
  • STE20
  • STE20-like kinase 3
  • STE20-like kinase MST3
  • sterile 20-like kinase 3
  • STK3yeast)

Background

The growth of axons is fundamental to the development and repair of brain circuitry. It has been shown that Mst3, a neuron-specific homolog of the yeast kinase Ste20, is critical for axon outgrowth. Mst3 is activated in response to trophic factors, and suppressing its expression or its function blocks axon outgrowth (1). Mst3 has been recently demonstrated to undergo a caspase-mediated cleavage during apoptosis. The proteolytic cleavage of the C-terminus of Mst3 caused nuclear translocation of its kinase domain. Mst3 contains both nuclear localization sequence (NLS) and NES signals, which may cooperate to control the subcellular distribution of Mst3 (2). In situ hybridization of rat brain sections indicated that MST3b is widely expressed in different brain regions, with especially high expression in hippocampus and cerebral cortex. When expressed in human embryonic kidney 293 (HEK293) cells, MST3b effectively phosphorylated myelin basic protein, as well as undergoing autophosphorylation (3)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82865
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-48284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP1-48021
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00010494-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, S-ELISA, WB
352-MS
Species: Hu
Applications: BA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-32181
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-58853
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-83024
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00009943-M16
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
AF5066
Species: Hu
Applications: WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
NBP3-35813
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-87833PEP
Species: Hu
Applications: AC

Publications for MST3 Protein (NBP1-87833PEP) (0)

There are no publications for MST3 Protein (NBP1-87833PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MST3 Protein (NBP1-87833PEP) (0)

There are no reviews for MST3 Protein (NBP1-87833PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MST3 Protein (NBP1-87833PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MST3 Products

Research Areas for MST3 Protein (NBP1-87833PEP)

Find related products by research area.

Blogs on MST3

There are no specific blogs for MST3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MST3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STK24