Recombinant Human MSL3L1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MSL3L1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 28856 of Human MSL3L1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVVVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDEN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MSL3
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MSL3L1 Protein

  • male-specific lethal 3 homolog (Drosophila)
  • male-specific lethal 3 homolog
  • male-specific lethal 3-like 1 (Drosophila)
  • male-specific lethal-3 (Drosophila)-like 1
  • Male-specific lethal-3 homolog 1
  • Male-specific lethal-3 protein-like 1
  • MSL3L1DKFZp586J1822
  • MSL3-like 1

Background

This gene encodes a nuclear protein and has similarity to drosophila male-specific lethal-3 gene. The drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus this encoded protein is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation. There are four alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28879
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBL1-11569
Species: Hu
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
NBP2-07996
Species: Hu
H00008360-R01
Species: Hu
NBL1-11570
Species: Hu
NBP2-10888
Species: Hu
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF
NBL1-11567
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP2-45893
Species: Hu
Applications: WB, IHC
49130002
Species: Ce
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF844
Species: Mu
Applications: WB, Block
NBP2-46538
Species: Hu
Applications: WB, IHC
NBP1-86577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
NBP1-89355
Species: Hu
Applications: IHC, IHC-P
NBP1-85157
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00010943-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MSL3L1 Partial Recombinant Protein (H00010943-Q01) (0)

There are no publications for MSL3L1 Partial Recombinant Protein (H00010943-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSL3L1 Partial Recombinant Protein (H00010943-Q01) (0)

There are no reviews for MSL3L1 Partial Recombinant Protein (H00010943-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MSL3L1 Partial Recombinant Protein (H00010943-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MSL3L1 Products

Bioinformatics Tool for MSL3L1 Partial Recombinant Protein (H00010943-Q01)

Discover related pathways, diseases and genes to MSL3L1 Partial Recombinant Protein (H00010943-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSL3L1 Partial Recombinant Protein (H00010943-Q01)

Discover more about diseases related to MSL3L1 Partial Recombinant Protein (H00010943-Q01).
 

Pathways for MSL3L1 Partial Recombinant Protein (H00010943-Q01)

View related products by pathway.

PTMs for MSL3L1 Partial Recombinant Protein (H00010943-Q01)

Learn more about PTMs related to MSL3L1 Partial Recombinant Protein (H00010943-Q01).

Blogs on MSL3L1

There are no specific blogs for MSL3L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MSL3L1 Antibody
H00010943-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MSL3L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MSL3