Recombinant Human MSL3L1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MSL3L1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-79 of Human MSL3L1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSASEGMKFKFHSGEKVLCFEPDPTKARVLYDAKIVVVIVGKDEKGRKIPEYLIHFNGWNRSWDRWAAEDHVLRDTDEN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MSL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
34.43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MSL3L1 GST (N-Term) Protein

  • male-specific lethal 3 homolog (Drosophila)
  • male-specific lethal 3 homolog
  • male-specific lethal 3-like 1 (Drosophila)
  • male-specific lethal-3 (Drosophila)-like 1
  • Male-specific lethal-3 homolog 1
  • Male-specific lethal-3 protein-like 1
  • MSL3L1DKFZp586J1822
  • MSL3-like 1

Background

This gene encodes a nuclear protein and has similarity to drosophila male-specific lethal-3 gene. The drosophila protein plays a critical role in a dosage-compensation pathway, which equalizes X-linked gene expression in males and females. Thus this encoded protein is thought to play a similar function in chromatin remodeling and transcriptional regulation. This gene has been found to undergo X inactivation. There are four alternatively spliced transcript variants of this gene encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83853
Species: Hu, Mu
Applications: ChIP, IP, WB
NBP2-76844
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
H00008294-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB21-2024
Species: Hu, Ma, Mu, Po, Rt
Applications: ChIP, DB, ICC/IF, WB
NBP2-07996
Species: Hu
Applications: WB
H00008363-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008362-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00008365-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
NBL1-11567
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45893
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-1307
Species: Hu, Mu, Po, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
AF844
Species: Mu
Applications: Block, IHC, WB
NBP2-67843
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3166
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-89355
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85157
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MSL3L1 Partial Recombinant Protein (H00010943-Q01) (0)

There are no publications for MSL3L1 Partial Recombinant Protein (H00010943-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSL3L1 Partial Recombinant Protein (H00010943-Q01) (0)

There are no reviews for MSL3L1 Partial Recombinant Protein (H00010943-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MSL3L1 Partial Recombinant Protein (H00010943-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MSL3L1 Products

Bioinformatics Tool for MSL3L1 Partial Recombinant Protein (H00010943-Q01)

Discover related pathways, diseases and genes to MSL3L1 Partial Recombinant Protein (H00010943-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MSL3L1 Partial Recombinant Protein (H00010943-Q01)

Discover more about diseases related to MSL3L1 Partial Recombinant Protein (H00010943-Q01).
 

Pathways for MSL3L1 Partial Recombinant Protein (H00010943-Q01)

View related products by pathway.

PTMs for MSL3L1 Partial Recombinant Protein (H00010943-Q01)

Learn more about PTMs related to MSL3L1 Partial Recombinant Protein (H00010943-Q01).

Blogs on MSL3L1

There are no specific blogs for MSL3L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MSL3L1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MSL3