Recombinant Human MRPS35 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human MRPS35 Protein [H00060488-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human MRPS35 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-323 of Human MRPS35 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
MRPS35
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
63.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MRPS35 GST (N-Term) Protein

  • 28S ribosomal protein S28, mitochondrial
  • DKFZp762P093
  • MDS023,28S ribosomal protein S35, mitochondrial
  • MGC104278
  • mitochondrial ribosomal protein S28
  • mitochondrial ribosomal protein S35
  • MRP-S28
  • MRPS28S35mt
  • MRP-S35
  • S28mt

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that has had confusing nomenclature in the literature. Pseudogenes corresponding to this gene are found on chromosomes 3p, 5q, and 10q. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33717
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-55415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NB100-1471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H00009412-M08
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-23368
Species: Hu
Applications: PAGE
NBP1-47659
Species: Hu
Applications: IHC, IHC-P, WB
H00002038-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-37371
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NBP3-13225
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00001040-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-30482
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00065008-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
AF7385
Species: Hu
Applications: ICC, WB
NBP1-88567
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP2-01826
Species: Ca, Hu, Mu
Applications: IHC, IHC-P, WB
AF1505
Species: Hu
Applications: CyTOF-ready, Flow, WB
MAB3241
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
H00003845-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB

Publications for MRPS35 Recombinant Protein (H00060488-P01) (0)

There are no publications for MRPS35 Recombinant Protein (H00060488-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS35 Recombinant Protein (H00060488-P01) (0)

There are no reviews for MRPS35 Recombinant Protein (H00060488-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRPS35 Recombinant Protein (H00060488-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPS35 Products

Bioinformatics Tool for MRPS35 Recombinant Protein (H00060488-P01)

Discover related pathways, diseases and genes to MRPS35 Recombinant Protein (H00060488-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS35 Recombinant Protein (H00060488-P01)

Discover more about diseases related to MRPS35 Recombinant Protein (H00060488-P01).
 

Pathways for MRPS35 Recombinant Protein (H00060488-P01)

View related products by pathway.

Blogs on MRPS35

There are no specific blogs for MRPS35, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MRPS35 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS35