MRPL47 Antibody - BSA Free Summary
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human MRPL47. Peptide sequence: VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MRPL47 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for MRPL47 Antibody - BSA Free
Background
MRPL47, also known as Mitochondrial Ribosomal Protein L47, contains a 29 kDa, 27 kDa, and 17 kDa isoform, and is involved in synthesizing proteins within the mitochondria. Current disease research is being conducted on the relationship between MRPL47 and nasopharyngitis, neuropathy, carcinoma, and a variety of genetic diseases. The protein interacts with ICT1, DVL2, DVL3, AARS2, and AASS through the process of translation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Ch, Hu, Mu, Po, Rt, Ze
Applications: IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Publications for MRPL47 Antibody (NBP2-85102) (0)
There are no publications for MRPL47 Antibody (NBP2-85102).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPL47 Antibody (NBP2-85102) (0)
There are no reviews for MRPL47 Antibody (NBP2-85102).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MRPL47 Antibody (NBP2-85102) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MRPL47 Products
Research Areas for MRPL47 Antibody (NBP2-85102)
Find related products by research area.
|
Blogs on MRPL47