MRPL28 Antibody [Alexa Fluor® 405]

Product Discontinued

MRPL28 Antibody [Alexa Fluor® 405] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-256 of human MRPL28 (NP_006419.2).
  
  Sequence:
  MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYGLDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL28
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for MRPL28 Antibody [Alexa Fluor® 405]

• L28mt
• MAAT139S ribosomal protein L28, mitochondrial
• Melanoma antigen p15
• melanoma-associated antigen recognised by cytotoxic T lymphocytes
• Melanoma-associated antigen recognized by T lymphocytes
• MGC8499
• mitochondrial ribosomal protein L28
• MRP-L28
• p15

Background

MRPL28, also known as 39 S ribosomal protein L28, mitochondrial, is a 30.2 kDa, 256 amino acid protein that is utilized in mitochondrial ribosomes as a member of the ribosomal protein L28P family. Diseases and disorders such as hepatitis, leukemia, bronchitis, inflammatory bowel disease, melanoma, vaccinia, influenza, esophagitis, hepatocellular carcinoma, Hodgkin's lymphoma, and rheumatoid arthritis are beings studied with this protein. The protein interacts with ENSG00000258947, TUBB4A, OXA1L, ICT1, and TUBB3.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRPL28