We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MRPL12 Recombinant Protein Antigen

Images

 
There are currently no images for MRPL12 Recombinant Protein Antigen (NBP1-85216PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MRPL12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPL12.

Source: E. coli

Amino Acid Sequence: VMSGAVPAAAAQEAVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MRPL12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85216.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRPL12 Recombinant Protein Antigen

  • 5c5-2
  • FLJ60124
  • L12mt
  • MGC8610
  • mitochondrial ribosomal protein L12
  • MRP-L12
  • MRP-L31/34
  • MRPL7
  • MRPL7/L12
  • RPML1239S ribosomal protein L12, mitochondrial

Background

MRPL12, also known as 39 S ribosomal protein L12, mitochondrial, is a 21.3 kDa, 198 amino acid protein that is involved in mitochondrial protein synthesis by forming homodimers in 39S subunits. Current research is being conducted to identify the effect of the protein on diseases such as prostate cancer and prostatitis. The protein interacts in translation pathways with other proteins such as ICT1, MRPL3, SRRM2, PPP2R2B, and TMEM51.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20211
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00026156-B01P
Species: Hu
Applications: ICC/IF, WB
H00028299-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-2269
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-78283
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP3-47027
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
AF1118
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ELISA, IHC
NBP1-71648
Species: Hu, Mu(-)
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-92880
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-38209
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-36751
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-90126
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-13254
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-31308
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-13429
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-94007
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-15299
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45910
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-93302
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB

Publications for MRPL12 Recombinant Protein Antigen (NBP1-85216PEP) (0)

There are no publications for MRPL12 Recombinant Protein Antigen (NBP1-85216PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL12 Recombinant Protein Antigen (NBP1-85216PEP) (0)

There are no reviews for MRPL12 Recombinant Protein Antigen (NBP1-85216PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MRPL12 Recombinant Protein Antigen (NBP1-85216PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRPL12 Products

Research Areas for MRPL12 Recombinant Protein Antigen (NBP1-85216PEP)

Find related products by research area.

Blogs on MRPL12

There are no specific blogs for MRPL12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MRPL12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL12