MRM1 Antibody

Western Blot: MRM1 Antibody [NBP1-83597] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: MRM1 Antibody [NBP1-83597] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.

Immunohistochemistry-Paraffin: MRM1 Antibody [NBP1-83597] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MRM1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SCQLLLTILPRRQLPPGLESLNVSVAAGILLHSICSQRKGFPTEGERRQLLQDPQEPSARSEGLSMAQHPGLSS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MRM1 Protein (NBP1-83597PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRM1 Antibody

• EC 2.1.1.-
• FLJ22578
• Mitochondrial large ribosomal RNA ribose methylase
• mitochondrial rRNA methyltransferase 1 homolog (S. cerevisiae)
• rRNA methyltransferase 1, mitochondrial

Background

Probably methylates the ribose of guanosine G-2270 in the peptidyl transferase center of the mitochondriallarge ribosomal RNA (21S)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MRM1