MPP2 Recombinant Protein Antigen

Images

 
There are currently no images for MPP2 Recombinant Protein Antigen (NBP3-17060PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MPP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MPP2

Source: E. coli

Amino Acid Sequence: GLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MPP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17060.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MPP2 Recombinant Protein Antigen

  • Discs large homolog 2
  • DKFZp686A06252
  • DKFZp686J2189
  • DKFZp761D0712
  • DLG2discs large, homolog 2
  • MAGUK p55 subfamily member 2
  • membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2)
  • Protein MPP2

Background

MPP2 (Palmitoylated membrane protein 2) is a member of a family of membrane-associated proteins termed MAGUKs (membrane-associated guanylate kinase homologs). MAGUKs interact with the cytoskeleton and regulate cell proliferation, signaling pathways, and intracellular junctions. MPP2/Palmitoylated membrane protein 2 contains a conserved sequence, called the SH3 (src homology 3) motif, found in several other proteins that associate with the cytoskeleton and are suspected to play important roles in signal transduction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB600-1229
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
AF3975
Species: Hu
Applications: ICC, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-87691
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85014
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46421
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00005662-B01P
Species: Hu, Rt
Applications: ICC/IF, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
H00004354-M01
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
NBP2-32630
Species: Hu
Applications: IHC, IHC-P
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
H00003996-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-88790
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-118
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for MPP2 Recombinant Protein Antigen (NBP3-17060PEP) (0)

There are no publications for MPP2 Recombinant Protein Antigen (NBP3-17060PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPP2 Recombinant Protein Antigen (NBP3-17060PEP) (0)

There are no reviews for MPP2 Recombinant Protein Antigen (NBP3-17060PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MPP2 Recombinant Protein Antigen (NBP3-17060PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MPP2 Products

Blogs on MPP2

There are no specific blogs for MPP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MPP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MPP2