MPHOSPH1 Antibody

Images

 
Immunohistochemistry-Paraffin: MPHOSPH1 Antibody [NBP1-88042] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MPHOSPH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KVETEEATACLELKFNQIKAELAKTKGELIKTKEELKKRENESDSLIQELETSNKKIITQNQRIKELINIIDQKEDTINEFQNLKSHMENTFKCNDKADTSSLIINNKLICNETVEVPKDSKSKICSERKRVNENELQQDEPPAKKGSI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIF20B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MPHOSPH1 Protein (NBP1-88042PEP)
Publications
Read Publication using NBP1-88042.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MPHOSPH1 Antibody

  • Cancer/testis antigen 90
  • CT90MPP-1
  • DKFZp434B0435
  • EC 6.3.5.5
  • kinesin family member 20B
  • Kinesin-related motor interacting with PIN1
  • KRMP1kinesin-like protein KIF20B
  • M-phase phosphoprotein 1mitotic kinesin-like protein
  • MPHOSPH1EC 2.1.1
  • MPP1DKFZp434P0810

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7745
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005034-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-83227
Species: Hu, Mu(-)
Applications: WB, IHC, IHC-P
NBP1-87801
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6638
Species: Hu, Mu, Rt
Applications: WB
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-17299
Species: Hu
Applications: WB, ICC/IF
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP1-85038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7979
Species: Hu, Mu, Rt
Applications: WB
NBP1-85014
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
AF2988
Species: Mu, Rt
Applications: WB
NBP1-88042
Species: Hu
Applications: IHC, IHC-P

Publications for MPHOSPH1 Antibody (NBP1-88042)(1)

Reviews for MPHOSPH1 Antibody (NBP1-88042) (0)

There are no reviews for MPHOSPH1 Antibody (NBP1-88042). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MPHOSPH1 Antibody (NBP1-88042) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPHOSPH1 Products

Bioinformatics Tool for MPHOSPH1 Antibody (NBP1-88042)

Discover related pathways, diseases and genes to MPHOSPH1 Antibody (NBP1-88042). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPHOSPH1 Antibody (NBP1-88042)

Discover more about diseases related to MPHOSPH1 Antibody (NBP1-88042).
 

Pathways for MPHOSPH1 Antibody (NBP1-88042)

View related products by pathway.

PTMs for MPHOSPH1 Antibody (NBP1-88042)

Learn more about PTMs related to MPHOSPH1 Antibody (NBP1-88042).
 

Research Areas for MPHOSPH1 Antibody (NBP1-88042)

Find related products by research area.

Blogs on MPHOSPH1

There are no specific blogs for MPHOSPH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPHOSPH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIF20B