MPHOSPH1 Antibody

Immunohistochemistry-Paraffin: MPHOSPH1 Antibody [NBP1-88042] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Discontinued

MPHOSPH1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KVETEEATACLELKFNQIKAELAKTKGELIKTKEELKKRENESDSLIQELETSNKKIITQNQRIKELINIIDQKEDTINEFQNLKSHMENTFKCNDKADTSSLIINNKLICNETVEVPKDSKSKICSERKRVNENELQQDEPPAKKGSI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KIF20B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MPHOSPH1 Antibody

• Cancer/testis antigen 90
• CT90MPP-1
• DKFZp434B0435
• EC 6.3.5.5
• kinesin family member 20B
• Kinesin-related motor interacting with PIN1
• KRMP1kinesin-like protein KIF20B
• M-phase phosphoprotein 1mitotic kinesin-like protein
• MPHOSPH1EC 2.1.1
• MPP1DKFZp434P0810

Background

MPHOSPH1, also known as Kinesin-like protein KIF20B, has 4 isoforms, a 1,820 amino acid isoform that is 211 kDa, a 1,853 amino acid isoform that is 214 kDa, a 1,780 amino acid isoform that is 200 kDa, and a 512 amino acid isoform that is 60 kDa, localizes mainly in the nucleus during interphase although it is also detected in the cytoplasm without clear association with microtubules, it is found in brain, ovary, kidney and testis, and acts as a plus-end-directed motor enzyme that is required for completion of cytokinesis. Disease research is currently being studied with relation to MPHOSPH1 and myeloproliferative disorder, intrahepatic cholangiocarcinoma, cholangiocarcinoma, Alzheimer's disease, and ataxia. This protein involvement has been observed with trelation to MYC, PIN1, RUVBL1, YWHAB, and CDK1proteins in M phase of mitotic cell cycle, ATP catabolic process, microtubule-based movement, cell cycle arrest, and mitosis pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MPHOSPH1 Antibody (NBP1-88042)(3)

Publications using NBP1-88042

• Li ZY, Wang ZX, Li CC. Kinesin family member 20B regulates tongue cancer progression by promoting cell proliferation. Mol Med Rep 2019-01-11 [PMID: 30664160] (IHC-P, Human)
• Abe T, Kohashi K, Takemoto J et al. Clinicopathological Significance and Antitumor Effect of MPHOSPH1 in Testicular Germ Cell Tumor. J. Cancer. 2018-11-04 [PMID: 30519350] (IHC-P, Human)
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: KIF20B