MON1A Antibody

Images

 
Western Blot: MON1A Antibody [NBP1-74123] - PANC1 Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MON1A Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of MON1A. Immunizing peptide sequence GIPDLRHFLYKSKSSGLFTSPEIEAPYTSEEEQERLLGLYQYLHSRAHNA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MON1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MON1A and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MON1A Antibody

  • FLJ97088
  • MON1 homolog A (yeast)
  • SAND1MGC13272
  • vacuolar fusion protein MON1 homolog A

Background

MON1A plays an important in membrane trafficking through the secretory apparatus. Not involved in endocytic trafficking to lysosomes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00338382-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-05048
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
NBP1-92131
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MON1A Antibody (NBP1-74123) (0)

There are no publications for MON1A Antibody (NBP1-74123).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MON1A Antibody (NBP1-74123) (0)

There are no reviews for MON1A Antibody (NBP1-74123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MON1A Antibody (NBP1-74123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MON1A Products

Bioinformatics Tool for MON1A Antibody (NBP1-74123)

Discover related pathways, diseases and genes to MON1A Antibody (NBP1-74123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MON1A Antibody (NBP1-74123)

Discover more about diseases related to MON1A Antibody (NBP1-74123).
 

Pathways for MON1A Antibody (NBP1-74123)

View related products by pathway.

Blogs on MON1A

There are no specific blogs for MON1A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MON1A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MON1A