We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MOCS1 Recombinant Protein Antigen

Images

 
There are currently no images for MOCS1 Protein (NBP1-92130PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MOCS1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MOCS1.

Source: E. coli

Amino Acid Sequence: LVPAKFEFIVRRKGFHKVMEGIHKAIELGYNPVKVNCVVMRGLNEDELLDFAALTEGLPLDVRFIEYMPFDGNKWNFKKMVSYK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MOCS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92130.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MOCS1 Recombinant Protein Antigen

  • molybdenum cofactor synthesis 1

Background

Molybdenum cofactor biosynthesis is a conserved pathway leading to the biological activation of molybdenum. The protein encoded by this gene is involved in molybdenum cofactor biosynthesis. This gene was originally thought to produce a bicistronic mRNA with the potential to produce two proteins (MOCS1A and MOCS1B) from adjacent open reading frames. However, only the first open reading frame (MOCS1A) has been found to encode a protein from the putative bicistronic mRNA. Two of the splice variants found for this gene express proteins (MOCS1A-MOCS1B) that result from a fusion between the two open reading frames. This gene is defective in patients with molybdenum cofactor deficiency, type A. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81045
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03449
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-32423
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16735
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF5928
Applications: ICC, IHC, WB
NBP2-17320
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-81988
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-83901
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-47496
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00023002-M03
Species: Hu, Mu, Rt
Applications: ELISA, IP, PLA, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NB300-113
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IP, WB
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-24716
Species: Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-54897
Species: Hu
Applications: IHC,  IHC-P
NB600-231
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP2-24615
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-85217
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for MOCS1 Protein (NBP1-92130PEP) (0)

There are no publications for MOCS1 Protein (NBP1-92130PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOCS1 Protein (NBP1-92130PEP) (0)

There are no reviews for MOCS1 Protein (NBP1-92130PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MOCS1 Protein (NBP1-92130PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MOCS1 Products

Array NBP1-92130PEP

Research Areas for MOCS1 Protein (NBP1-92130PEP)

Find related products by research area.

Blogs on MOCS1

There are no specific blogs for MOCS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MOCS1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MOCS1