MNAB Antibody - BSA Free

Western Blot: MNAB Antibody [NBP1-55060] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: MNAB Antibody [NBP1-55060] - Human Adult Placenta.

Western Blot: MNAB Antibody [NBP1-55060] - Human Fetal Lung.

Western Blot: MNAB Antibody [NBP1-55060] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

Western Blot: MNAB Antibody [NBP1-55060] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml RC3H2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MNAB Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to RC3H2(ring finger and CCCH-type zinc finger domains 2) The peptide sequence was selected from the middle region of RC3H2. Peptide sequence YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RC3H2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 118 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MNAB Antibody - BSA Free

• FLJ20301
• FLJ20713
• membrane associated DNA binding protein
• membrane-associated nucleic acid binding protein
• Membrane-associated nucleic acid-binding protein
• MGC52176
• MNAB
• ring finger and CCCH-type domains 2
• RING finger and CCCH-type zinc finger domain-containing protein 2
• ring finger and CCCH-type zinc finger domains 2
• RNF164RING finger protein 164

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RC3H2