MICB Antibody

Images

 
Western Blot: MICB Antibody [H00004277-B01P] - Analysis of MICB expression in transfected 293T cell line by MICB polyclonal antibody. Lane 1: MICB transfected lysate(37.4 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MICB Antibody Summary

Immunogen
MICB (AAH44218.1, 1 a.a. - 340 a.a.) full-length human protein. MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTEGA
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MICB
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MICB Antibody

  • MHC class I chain-related protein B
  • MHC class I mic-B antigen
  • MHC class I polypeptide-related sequence B
  • MICB
  • MIC-B
  • PERB11.2MHC class I-like molecule PERB11.2-IMX
  • stress inducible class I homolog

Background

This gene encodes a heavily glycosylated protein which is a ligand for the NKG2D type II receptor. Binding of the ligand activates the cytolytic response of natural killer (NK) cells, CD8 alphabeta T cells, and gammadelta T cells which express the receptor. This protein is stress-induced and is similar to MHC class I molecules; however, it does not associate with beta-2-microglobulin or bind peptides.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB1380
Species: Hu
Applications: Flow, Block, CyTOF-ready
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-61007
Species: Hu, Alp, AB, Bv, Ca, Eq, Fe, Ft, Gt, Ha, Ll, Mn, Rb, Sh, WB
Applications: Flow, Func, IHC
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
MAB1517
Species: Hu
Applications: Flow, Block, CyTOF-ready
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
H00003125-B02P
Species: Hu
Applications: WB, Flow
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-55403
Species: Hu
Applications: WB, PEP-ELISA
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
H00004277-B01P
Species: Hu
Applications: WB

Publications for MICB Antibody (H00004277-B01P) (0)

There are no publications for MICB Antibody (H00004277-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MICB Antibody (H00004277-B01P) (0)

There are no reviews for MICB Antibody (H00004277-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MICB Antibody (H00004277-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MICB Products

Bioinformatics Tool for MICB Antibody (H00004277-B01P)

Discover related pathways, diseases and genes to MICB Antibody (H00004277-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MICB Antibody (H00004277-B01P)

Discover more about diseases related to MICB Antibody (H00004277-B01P).
 

Pathways for MICB Antibody (H00004277-B01P)

View related products by pathway.

PTMs for MICB Antibody (H00004277-B01P)

Learn more about PTMs related to MICB Antibody (H00004277-B01P).

Blogs on MICB

There are no specific blogs for MICB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MICB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MICB
Entrez
Uniprot