METTL2B Antibody

Images

 
Western Blot: METTL2B Antibody [NBP1-55020] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

METTL2B Antibody Summary

Immunogen
Synthetic peptides corresponding to METTL2B(methyltransferase like 2B) The peptide sequence was selected from the N terminal of METTL2B. Peptide sequence AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METTL2B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against METTL2B and was validated on Western blot.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for METTL2B Antibody

  • EC 2.1.1
  • EC 2.1.1.-
  • FLJ11350
  • FLJ12760
  • methyltransferase like 2
  • methyltransferase like 2B
  • methyltransferase-like protein 2B
  • METL
  • METTL2
  • METTL2A
  • PSENIP1

Background

METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases.This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22523
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00000875-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, IP, RNAi
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87486
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57880
Species: Hu
Applications: ICC/IF
NBP2-12553
Species: Hu
NBP1-59791
Species: Hu
Applications: WB, IHC, IHC-P
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-54633
Species: Hu
Applications: WB, IHC
NBP1-55020
Species: Hu
Applications: WB

Publications for METTL2B Antibody (NBP1-55020) (0)

There are no publications for METTL2B Antibody (NBP1-55020).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL2B Antibody (NBP1-55020) (0)

There are no reviews for METTL2B Antibody (NBP1-55020). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for METTL2B Antibody (NBP1-55020) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional METTL2B Products

Bioinformatics Tool for METTL2B Antibody (NBP1-55020)

Discover related pathways, diseases and genes to METTL2B Antibody (NBP1-55020). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on METTL2B

There are no specific blogs for METTL2B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our METTL2B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL2B
Uniprot