Recombinant Human METTL14 GST (N-Term) Protein

Images

 
Recombinant Human METTL14 Protein [H00057721-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human METTL14 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-456 of Human METTL14 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
METTL14
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
78.6 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human METTL14 GST (N-Term) Protein

  • EC 2.1.1
  • EC 2.1.1.-
  • KIAA1627
  • KIAA1627methyltransferase-like protein 14
  • methyltransferase like 14
  • METTL14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47318
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00023435-M01
Species: Hu, Mu, Rt, Ba, Pp, I, Pm
Applications: WB, ELISA, Func, ICC/IF, IHC, IHC-P, IP, RNAi, S-ELISA
NBP2-93547
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB7325
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-75610
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03819
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-22218
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3758
Species: Hu, Mu
Applications: WB, Simple Western, ICC, KO
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56363
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00057721-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for METTL14 Recombinant Protein (H00057721-P01) (0)

There are no publications for METTL14 Recombinant Protein (H00057721-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL14 Recombinant Protein (H00057721-P01) (0)

There are no reviews for METTL14 Recombinant Protein (H00057721-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for METTL14 Recombinant Protein (H00057721-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional METTL14 Products

Bioinformatics Tool for METTL14 Recombinant Protein (H00057721-P01)

Discover related pathways, diseases and genes to METTL14 Recombinant Protein (H00057721-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for METTL14 Recombinant Protein (H00057721-P01)

Discover more about diseases related to METTL14 Recombinant Protein (H00057721-P01).
 

Pathways for METTL14 Recombinant Protein (H00057721-P01)

View related products by pathway.

Research Areas for METTL14 Recombinant Protein (H00057721-P01)

Find related products by research area.

Blogs on METTL14

There are no specific blogs for METTL14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human METTL14 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL14