| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 3E8 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | MT3 (AAH13081, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
| Specificity | MT3 - metallothionein 3 (growth inhibitory factor (neurotrophic)) (3E8) |
| Isotype | IgM Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MT3 |
| Purity | Unpurified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | Ascites |
| Preservative | No Preservative |
| Purity | Unpurified |
| Publication using H00004504-M01A | Applications | Species |
|---|---|---|
| Martinho A, Goncalves I, Cardoso I et al. Human metallothioneins 2 and 3 differentially affect amyloid-beta binding by transthyretin. FEBS J. 2010-07-14 [PMID: 20646067] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MT3 |
| Entrez |
|
| Uniprot |
|