Metallothionein-3 Antibody (3E8)

Western Blot: Metallothionein-3 Antibody (3E8.) [H00004504-M01A] - Detection against Immunogen (33.11 KDa) .

• Reactivity: Hu, Rt
• Applications: WB, ELISA, ICC/IF
• Clone: 3E8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

Metallothionein-3 Antibody (3E8) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MT3 (AAH13081, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ
• Specificity: MT3 - metallothionein 3 (growth inhibitory factor (neurotrophic)) (3E8)
• Isotype: IgM Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MT3
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: Ascites
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Metallothionein-3 Antibody (3E8)

• GIFBmetallothionein-3
• GIFGRIF
• Growth inhibitory factor
• metallothionein 3 (growth inhibitory factor (neurotrophic))
• metallothionein 3
• metallothionein-III
• MT-3
• MT-III

Background

Metallothionein-3 binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Metallothionein-3 Antibody (H00004504-M01A)(1)

Publication using H00004504-M01A

• Martinho A, Goncalves I, Cardoso I et al. Human metallothioneins 2 and 3 differentially affect amyloid-beta binding by transthyretin. FEBS J. 2010-07-14 [PMID: 20646067]

Bioinformatics

• Gene Symbol: MT3
• Entrez:
  • 4504(Human)
• Uniprot:
  • AAH13081.1(Human)