Reactivity | HuSpecies Glossary |
Applications | WB, ICC/IF |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Immunogen | GOSR2 (NP_473363.1, 1 a.a. - 213 a.a.) full-length human protein. MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGTQGSCQTAHFGGRSAGSS |
Specificity | GOSR2 - golgi SNAP receptor complex member 2, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | GOSR2 |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. It has also been used for immunofluorescence. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Publication using H00009570-B01P | Applications | Species |
---|---|---|
Jolly LA, Sun Y, Carroll R et al. Robust imaging and gene delivery to study human lymphoblastoid cell lines. J Hum Genet 2018-06-20 [PMID: 29925960] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Membrin Antibody (H00009570-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | GOSR2 |
Entrez |
|
Uniprot |
|