Melanopsin Antibody - BSA Free

Western Blot: Melanopsin Antibody [NBP3-10119] - Western blot analysis of Melanopsin in Mouse Kidney lysates. Antibody dilution at 1ug/ml

Product Discontinued

Melanopsin Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of Mouse Melanopsin (NP_001122071.1). Peptide sequence AAAWVPFPTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRT
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OPN4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 51 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Melanopsin Antibody - BSA Free

• Melanopsin
• MGC142118
• MOP
• OPN4
• opsin 4
• Opsin-4

Background

Melanopsin is an opsin-like protein found in the retinal ganglion cells of mammals. Melanopsin is believed to be part of a secondary optical system that parallels that of the classic rod and cone system. This second system reports directly to the suprachiasmatic nucleus and is responsible for regulation of circadian rhythms. Melanopsin is believed to be the primary photopigment responsible for the regulation of these circadian rhythms, and Melanopsin knockout mice have been generated which demonstrate decreased capacity to entrain to light and dark cycles.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OPN4