MEK5 Recombinant Protein Antigen

Images

 
There are currently no images for MEK5 Protein (NBP1-89654PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MEK5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP2K5.

Source: E. coli

Amino Acid Sequence: IFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAP2K5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89654.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MEK5 Recombinant Protein Antigen

  • HsT17454
  • MAP kinase kinase 5
  • MAP kinase kinase MEK5b
  • MAP2K5
  • MAPK/ERK kinase 5
  • MAPKK 5
  • MAPKK5
  • MAPKK5EC 2.7.12.2
  • MEK5
  • MEK5MEK 5
  • mitogen-activated protein kinase kinase 5
  • MKK5
  • PRKMK5
  • PRKMK5dual specificity mitogen-activated protein kinase kinase 5

Background

Mitogen-acitvated protein kinase kinase 5 (MKK5) belongs to the serine/threonine protein kinase family and the MAPK kinase subfamily (MAP2K, MKK or MEKs). MAPKs require dual phosphorylation on threonine and tyrosine residues, an activation step carried out by MAPK kinase (1-2). The MAPK cascade plays an important role in signaling defense responses. Of the MKK family members, MKK5 exhibits the closest homology to MEK1 and MEK2, with 46% amino acid identity in the catalytic domain (3) MKK has been show to activate extracellular-signal-regulated protein kinase 5 (ERK5). Also, activated ERK5 phosphorylates mitogen- MKK5 extensively at Ser129, Ser137, Ser142 and Ser149, which are located within the region in MKK5 that is thought to interact with ERK5 (3). There have also been findings to that the MEK5 (MKK5)/ERK5 (BMK) pathway may play a role in prostate cancer (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2848
Species: Hu, Mu
Applications: ICC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MAB7128
Species: Hu, Mu, Rt
Applications: ICC, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
236-EG
Species: Hu
Applications: BA
MAB6095
Species: Hu
Applications: KO, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for MEK5 Protein (NBP1-89654PEP) (0)

There are no publications for MEK5 Protein (NBP1-89654PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEK5 Protein (NBP1-89654PEP) (0)

There are no reviews for MEK5 Protein (NBP1-89654PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MEK5 Protein (NBP1-89654PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MEK5 Products

Research Areas for MEK5 Protein (NBP1-89654PEP)

Find related products by research area.

Blogs on MEK5

There are no specific blogs for MEK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MEK5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP2K5