MED19 Antibody - Azide and BSA Free

Western Blot: MED19 Antibody [NBP3-05123] - Analysis of extracts of various cell lines, using MED19 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Product Discontinued

MED19 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-160 of human MED19 (NP_703151.1). AGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MED19 Antibody - Azide and BSA Free

• LCMR1mediator of RNA polymerase II transcription subunit 19
• Lung cancer metastasis-related protein 1
• mediator complex subunit 19DT2P1G7
• mediator of RNA polymerase II transcription, subunit 19 homolog (S. cerevisiae)
• mediator of RNA polymerase II transcription, subunit 19 homolog

Background

MED19 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activatetranscription via RNA polymerase II (Sato et al., 2003 (PubMed 12584197)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MED19