Recombinant Human MED16 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MED16 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human THRAP5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MED16

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MED16 Protein

  • DRIP92thyroid hormone receptor associated protein 5
  • mediator complex subunit 16THRAP5
  • mediator of RNA polymerase II transcription subunit 16
  • Thyroid hormone receptor-associated protein 5
  • Thyroid hormone receptor-associated protein complex 95 kDa component
  • thyroid hormone receptor-associated protein, 95-kD subunit
  • TRAP95
  • Vitamin D3 receptor-interacting protein complex 92 kDa component

Background

THRAP5 - thyroid hormone receptor associated protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89018
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74599
Species: Hu, Mu
Applications: WB, IP
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NBP1-87818
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001024-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB200-338
Species: Hu, Mu
Applications: WB (-), IP
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-81320
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NBP2-24393
Species: Hu
Applications: WB
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-84140
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-31617
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MED16 Partial Recombinant Protein (H00010025-Q01) (0)

There are no publications for MED16 Partial Recombinant Protein (H00010025-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED16 Partial Recombinant Protein (H00010025-Q01) (0)

There are no reviews for MED16 Partial Recombinant Protein (H00010025-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MED16 Partial Recombinant Protein (H00010025-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED16 Products

Bioinformatics Tool for MED16 Partial Recombinant Protein (H00010025-Q01)

Discover related pathways, diseases and genes to MED16 Partial Recombinant Protein (H00010025-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED16 Partial Recombinant Protein (H00010025-Q01)

Discover more about diseases related to MED16 Partial Recombinant Protein (H00010025-Q01).
 

Pathways for MED16 Partial Recombinant Protein (H00010025-Q01)

View related products by pathway.

Research Areas for MED16 Partial Recombinant Protein (H00010025-Q01)

Find related products by research area.

Blogs on MED16

There are no specific blogs for MED16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MED16 Antibody (2B7)
H00010025-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MED16 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MED16