MED15 Recombinant Protein Antigen

Images

 
There are currently no images for MED15 Protein (NBP1-89018PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MED15 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MED15.

Source: E. coli

Amino Acid Sequence: QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MED15
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89018.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MED15 Recombinant Protein Antigen

  • ARC105Arc105
  • CAG7A
  • CTG repeat protein 7a
  • CTG7A
  • FLJ42282
  • FLJ42935
  • mediator complex subunit 15PC2 glutamine/Q-rich-associated protein
  • mediator of RNA polymerase II transcription subunit 15
  • PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associatedprotein
  • PC2-glutamine-rich-associated protein
  • PCQAPDKFZp686A2214
  • Positive cofactor 2 glutamine/Q-rich-associated protein
  • positive cofactor 2, glutamine/Q-rich-associated protein
  • TIG1DKFZp762B1216
  • TIG-1TPA-inducible gene 1 protein
  • TNRC7
  • TPA inducible gene-1
  • TPA inducible protein
  • trinucleotide repeat containing 7,105-kD
  • Trinucleotide repeat-containing gene 7 protein

Background

MED15 is encoded by this gene is a subunit of the multiprotein complexes PC2 and ARC/DRIP and may function as a transcriptional coactivator in RNA polymerase II transcription. This gene contains stretches of trinucleotide repeats and is located in the chromosome 22 region which is deleted in DiGeorge syndrome. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45517
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46076
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB200-323
Species: Hu, Rt
Applications: WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-00637
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF4885
Species: Mu
Applications: IP, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-56929
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-13225
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-26616
Species: Hu
Applications: IP, WB
NBP3-48492
Species: Hu, Mu
Applications: IHC, IHC-Fr, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-24530
Species: Bv, Hu, Mu, Rt
Applications: Flow-IC, IHC,  IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
DTSP10
Species: Hu
Applications: ELISA

Publications for MED15 Protein (NBP1-89018PEP) (0)

There are no publications for MED15 Protein (NBP1-89018PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED15 Protein (NBP1-89018PEP) (0)

There are no reviews for MED15 Protein (NBP1-89018PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MED15 Protein (NBP1-89018PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED15 Products

Blogs on MED15.

TAZ Antibody: The Devil is in the Details
WW domain-containing transcription regulator protein 1 also known as WWTR1 and TAZ, is a 44KDa protein that acts as a downstream regulatory target in the Hippo signaling pathway. This protein undergoes post-translational modification and becomes phosp...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MED15 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MED15