MARCH3 Antibody

Images

 
Western Blot: MARCH3 Antibody [NBP1-74194] - Mouse Kidney Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MARCH3 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of March3. Immunizing peptide sequence PLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARCH3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against March3 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MARCH3 Antibody

  • EC 6.3.2
  • EC 6.3.2.-
  • MARCH-IIIFLJ20096
  • membrane-associated ring finger (C3HC4) 3
  • Membrane-associated RING finger protein 3
  • Membrane-associated RING-CH protein III
  • MGC48332
  • RING finger protein 173
  • RNF173E3 ubiquitin-protein ligase MARCH3

Background

March3 is an E3 ubiquitin-protein ligase which may be involved in endosomal trafficking. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97889
Species: Hu, Mu, Rt, Po, Bv, Ca, Rb, Sh, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr
NBP1-91638
Species: Hu
Applications: WB, IHC, IHC-P
AF5664
Species: Hu
Applications: WB, IHC, ICC
NBP1-81821
Species: Hu
Applications: Simple Western, IHC, IHC-P
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-33867
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49011
Species: Hu
Applications: IHC
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP1-78444
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-80837
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP2-58397
Species: Hu
Applications: WB, ICC/IF
NBP1-41070
Species: Hu
Applications: WB, IP, PLA
NBP2-33814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80773
Species: Hu
Applications: IHC, IHC-P
NBP1-92438
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MARCH3 Antibody (NBP1-74194) (0)

There are no publications for MARCH3 Antibody (NBP1-74194).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARCH3 Antibody (NBP1-74194) (0)

There are no reviews for MARCH3 Antibody (NBP1-74194). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MARCH3 Antibody (NBP1-74194) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MARCH3 Products

Bioinformatics Tool for MARCH3 Antibody (NBP1-74194)

Discover related pathways, diseases and genes to MARCH3 Antibody (NBP1-74194). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARCH3 Antibody (NBP1-74194)

Discover more about diseases related to MARCH3 Antibody (NBP1-74194).
 

Pathways for MARCH3 Antibody (NBP1-74194)

View related products by pathway.

PTMs for MARCH3 Antibody (NBP1-74194)

Learn more about PTMs related to MARCH3 Antibody (NBP1-74194).

Blogs on MARCH3

There are no specific blogs for MARCH3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MARCH3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MARCH3
Uniprot