Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.
Reactivity | HuSpecies Glossary |
Applications | WB, ELISA, S-ELISA |
Clone | 4H2 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | MAP1S (NP_060644.4, 929 a.a. ~ 1026 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE |
Specificity | Reacts with microtubule-associated protein 1S. |
Isotype | IgG2a Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | MAP1S |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | This antibody is reactive against recombinant protein in western blot and ELISA. |
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | In 1x PBS, pH 7.4 |
Preservative | No Preservative |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Diseases for MAP1S Antibody (H00055201-M05)Discover more about diseases related to MAP1S Antibody (H00055201-M05).
| Pathways for MAP1S Antibody (H00055201-M05)View related products by pathway.
|
PTMs for MAP1S Antibody (H00055201-M05)Learn more about PTMs related to MAP1S Antibody (H00055201-M05).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.