Home » MAP1S » MAP8 Research Products » MAP1S Antibody (4H2)

MAP1S Antibody (4H2)

 Submit a Review

Images

 
(
Enlarge)
Sandwich ELISA: MAP1S Antibody (4H2) [H00055201-M05] - Detection limit for recombinant GST tagged MAP1S is 0.1 ng/ml as a capture antibody.
Sandwich ELISA: MAP1S Antibody (4H2) [H00055201-M05] - Detection limit for recombinant GST tagged MAP1S is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
4H2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MAP1S Antibody (4H2) Summary

Immunogen
MAP1S (NP_060644.4, 929 a.a. ~ 1026 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISGQDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAE
Specificity
Reacts with microtubule-associated protein 1S.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAP1S
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Sandwich ELISA
Application Notes
This antibody is reactive against recombinant protein in western blot and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAP1S Antibody (4H2)

  • BPY2 interacting protein 1
  • BPY2IP1VCY2IP-1
  • C19orf5
  • chromosome 19 open reading frame 5
  • FLJ10669
  • MAP8MAP-1S
  • MGC133087
  • microtubule-associated protein 1S
  • Microtubule-associated protein 8
  • Variable charge Y chromosome 2-interacting protein 1
  • VCY2 interacting protein 1
  • VCY2-interacting protein 1
  • VCY2IP1BPY2-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAP1B [p Thr1265]
Antibody - SuperBUGS
NBP1-42827
Western Blot: MAP1B [p Thr1265] Antibody - SuperBUGS [NBP1-42827] - Analysis of phosphorylated MAP1B in chick embryos (lane 1) and rat neonatal brain (lane 2).
Immunohistochemistry: MAP1B [p Thr1265] Antibody - SuperBUGS [NBP1-42827] - Immunohistochemical analysis of rat spinal cord transverse section from an E12 embryo.
Western Blot: MAP1B [p Thr1265] Antibody - SuperBUGS [NBP1-42827] - Western blot analysis of p62, Nbr1, MAP1B-HC, and MAP1B-LC1 protein levels following blockage of autophagic protein degradation. Phospho-MAP1B-HC is degraded by autophagy. Upon blockage of autophagic degradation with Bafilomycin A1: (Baf), levels of phospho-MAP1B-HC increase compared with levels of total MAP1B-HC. Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/ijcb/2012/208014/), licensed under a CC-BY licence.
(8 Publications)
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
RASSF1 Antibody
(OTI2B11)
NBP2-03644
Western Blot: RASSF1 Antibody (2B11) [NBP2-03644] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RASSF1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RASSF1.
Immunocytochemistry/Immunofluorescence: RASSF1 Antibody (2B11) [NBP2-03644] Staining of COS7 cells transiently transfected by pCMV6-ENTRY RASSF1.
Immunohistochemistry-Paraffin: RASSF1 Antibody (2B11) [NBP2-03644] - Staining of paraffin-embedded Human prostate tissue using anti-RASSF1 mouse monoclonal antibody.
(1 Publication)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAP1A Antibody
NBP2-32630
Immunohistochemistry-Paraffin: MAP1A Antibody [NBP2-32630] - Staining of human lymph node.
Immunohistochemistry-Paraffin: MAP1A Antibody [NBP2-32630] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: MAP1A Antibody [NBP2-32630] - Staining of human pancreas shows low expression as expected.
Species: Hu
Applications: IHC, IHC-P
Methionine
Aminopeptidase 1/META ...
AF3537
Methionine Aminopeptidase 1/METAP1 Antibody
Species: Hu
Applications: WB, IP
LRPPRC Antibody
NBP1-83349
Western Blot: LRPPRC Antibody [NBP1-83349] - Analysis in Hep-G2 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LRPPRC antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: LRPPRC Antibody [NBP1-83349] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LRPPRC Antibody [NBP1-83349] - Staining of human colon.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Gigaxonin Antibody
NBP1-49924
Western Blot: Gigaxonin Antibody [NBP1-49924] - The Kelch domain of GIG interacts with intermediate filament proteins. Endogenous VIM pulls down endogenous GIG. Indicated lysates were subjected to immunoprecipitation with either VIM antibody or control IgG (used as the mock condition throughout), and the membrane was probed sequentially for endogenous GIG and then VIM (not shown). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0140157), licensed under a CC-BY licence.
Immunoprecipitation: Gigaxonin Antibody [NBP1-49924] - Samples: Whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. Antibodies: Affinity purified rabbit anti-Gigaxonin antibody NBP1-49924 used for IP at 3 ug/mg lysate. Gigaxonin was also immunoprecipitated by rabbit anti-Gigaxonin antibody NBP1-49923, which recognizes an upstream epitope. For blotting immunoprecipitated Gigaxonin, NBP1-49924 was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunoprecipitation: Gigaxonin Antibody [NBP1-49924] - The Kelch domain of GIG interacts with intermediate filament proteins. GIG pulls down overexpressed PRPH in a Kelch-dependent manner. Cell lysates were subjected to immunoprecipitation with anti-Flag beads or IgG, and the membrane was probed sequentially for PRPH then GIG (not shown). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0140157), licensed under a CC-BY licence.
(1 Publication)
Species: Hu
Applications: WB, IP
SGSM3 Antibody
NBP2-13304
Western Blot: SGSM3 Antibody [NBP2-13304] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: SGSM3 Antibody [NBP2-13304] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SGSM3 Antibody [NBP2-13304] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PSD-95 Antibody
(6G6-1C9)
NB300-556
Western Blot: PSD-95 Antibody (6G6-1C9) [NB300-556] - Analysis of 25 ug of mouse brain (lane 1) and rat brain (lane 2) cell lysates.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Control immunolocalization of plasma membrane AMPA receptor subunits (external epitopes) in hippocampal neuronal cultures. H) Immunolabeling of non-permeabilized neuronal cultures with ani-GluA1 (green). (I) Immunolabeling with the postsynaptic marker anti-PSD95 [66] after permeabilization of neuronal cultures. (J) Merging of (H) and (I) showing postsynaptic labeling of GluA1. Scale bar (valid for all images): 10 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0140868), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: PSD-95 Antibody (6G6-1C9) [NB300-556] - Confocal images of dissociated hippocampal cultures. Double labeling with anti-syntaxin-1 Double labeling with antibodies against syntaxin-1 (D) and synaptophysin (E) indicates that syntaxin-1 is colocalized with presynaptic marker (F). Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/Article/10.3389/fnmol.2016.00010/abstract), licensed under a CC-BY licence.
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
IL-6 [HRP]
D6050
(25 Reviews)
(465 Publications)
Species: Hu
WDR47 Antibody
NBP1-81463
Western Blot: WDR47 Antibody [NBP1-81463] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: WDR47 Antibody [NBP1-81463] - Staining of human cell line U-2 OS shows localization to actin filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: WDR47 Antibody [NBP1-81463] - Staining of human kidney shows distinct cytoplasmic positivity in a subset of renal tubules.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAP1 Antibody (4A1)
H00064112-M02
Western Blot: MAP1 Antibody (4A1) [H00064112-M02] - Analysis of MOAP1 expression in transfected 293T cell line by MOAP1 monoclonal antibody (M02), clone 4A1.Lane 1: MOAP1 transfected lysate(39.5 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: MAP1 Antibody (4A1) [H00064112-M02] - Analysis of monoclonal antibody to MOAP1 on HeLa cell. Antibody concentration 10 ug/ml.
Sandwich ELISA: MAP1 Antibody (4A1) [H00064112-M02] - Detection limit for recombinant GST tagged MOAP1 is 0.3 ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Complement Factor
MASP3/MASP1 [Unconjug ...
1724-SE
Complement Factor MASP3/MASP1 [Unconjugated]
(1 Publication)
Species: Hu
LC3A Antibody
NB100-2331
Western Blot: LC3A Antibody [NB100-2331] - High autophagosome concentration is consumed during early immortalized human mesenchymal stem cell differentiation. Immortalized human mesenchymal stem cells were differentiated under osteogenic conditions (see Materials and methods) and assayed for changes in LC3I and LC3II during a 72-hour window. Cells were differentiated under standard conditions (top) or with addition of 5 uM rapamycin (middle) or 5 nM bafilomycin (bottom) for the first 3 hours of differentiation to modulate autophagy. Immunoblots were performed for LC3 at the indicated time points to assess autophagosome degradation via relative changes in LC3II (lower band; 17 kDa). Studies were repeated three times with similar trends seen consistently. Image collected and cropped by CiteAb from the following publication (http://stemcellres.com/content/5/6/140), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: LC3A Antibody [NB100-2331] - Analysis in PFA fixed NIH/3T3 cells using anti-LC3A antibody. Image from verified customer review.
Immunohistochemistry: LC3A Antibody [NB100-2331] - Staining in mouse meniscus and cartilage. Image from verified customer review.
(20 Reviews)
(255 Publications)
Species: Hu, Mu, Rt, Ca, Fi, Pl, V, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB, IHC-WhMt
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - Analysis of a FFPE human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(10 Publications)
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
GATE-16/GABARAPL2
Antibody
NBP2-82090
Western Blot: GATE-16/GABARAPL2 Antibody [NBP2-82090] - Analysis of GATE-16/GABARAPL2 in human brain tissue lysate with GATE-16/GABARAPL2 antibody at (A) 1 and (B) 2 ug/ml.
Immunocytochemistry/Immunofluorescence: GATE-16/GABARAPL2 Antibody [NBP2-82090] - Immunofluorescence of GATE-16/GABARAPL2 in mouse brain tissue with GATE-16/GABARAPL2 Antibody at 20 ug/mL. Green: GATE-16/GABARAPL2 Antibody (NBP2-82090). Blue: DAPI staining
Immunohistochemistry-Paraffin: GATE-16/GABARAPL2 Antibody [NBP2-82090] - Mouse brain tissue with at 5 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAP2 Antibody
NB300-213
Immunocytochemistry/Immunofluorescence: MAP2 Antibody [NB300-213] - Mouse primary cultures stained with MAP2 antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: MAP2 Antibody [NB300-213] - Immunofluorescent analysis of cortical neuron-glial cell culture from E20 rat stained with chicken pAb to microtubule associated protein 2 (MAP2), NB300-213, dilution 1:10,000 in red, and mouse mAb to MAP-tau, NPB2-25162, dilution 1:2,000, in green. The blue is DAPI staining of nuclear DNA. NB300-213 antibody stains dendrites and perikarya of neurons, while NBP2-25162 antibody labels neuronal perikarya, dendrites and also axonal process. As a result perikarya and dendrites appears orange-yellow, since they contain both MAP2 and tau, while axons are green.
Western Blot: MAP2 Antibody [NB300-213] - Western blot analysis of whole brain tissue lysates using chicken pAb to microtubule associated protein 2 (MAP2), NB300-213, dilution 1:50,000 in green: [1] protein standard (red), [2] adult rat brain, [3] embryonic E20 rat brain, [4] adult mouse brain. Strong band observed at ~280kDa mark corresponds to two major isoforms of MAP2 protein referred to as MAP2A and MAP2B. Smaller fragments of these isoforms are also detected if the antibody is used at higher concentrations.
(4 Reviews)
(59 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KD
IKK gamma
Inhibitor Peptide Set
NBP2-26504
In vivo assay: IKK gamma Inhibitor Peptide Set [NBP2-26504] - NBD peptide blocks constitutive NF-kB as shown by EMSA. U266 cells were treated with 100 uM of control or NBD peptide for different time periods. Nuclear extracts were isolated and checked for NF-kB-DNA binding activity.
In vivo assay: IKK gamma Inhibitor Peptide Set [NBP2-26504] - NBD peptide blocks constitutive NF-kB activation in human multiple myeloma cells. U266 cells were treated with 100 uM of control (A & B) or NBD peptide (C & D) for 12 hr, cytospun, plated on glass slides, air dried for 1 hr at room temperature and fixed with cold acetone. Slides were blocked with 5% normal goat serum for 1 hr and then incubated with rabbit polyclonal anti-human p65 antibody (A & C) followed by Ig-Alexa 594 second step. In control peptide treated cells, p65 translocates to nucleus (A), whereas NBD peptide prevents translocation of p65 into the nucleus (C). B & D: Nuclear staining with DNA binding dye.
IKK gamma Inhibitor Peptide Set [NBP2-26504] - The IKK complex consists of IKKalpha + IKKbeta+ NEMO. NEMO (IKKgamma/NF-kB Essential MOdulator) is a scaffold protein required for the kinase activity of IKKalpha + IKKbeta. NBD (NEMO Binding Domain) inhibits formation of the IKK complex (IKKalpha + IKKbeta+ NEMO) by binding to NEMO and blocking IKK complex formation. In this regard, NBD is considered to be an 'IKKalpha and IKKBeta decoy' Blocking IKK complex formation suppresses downstream events in the NF-kB signaling pathway that rely on the IKK complex including phosphorylation of IkBalpha, and subsequence IkBalpha ubiquination, degradation and release of NF-kB. Hence, NF-kB is retained in the cytoplasm in its inactive state.
(23 Publications)
Species: Hu, Mu, Rt
MAP1S Antibody
(4H2)
H00055201-M05
MAP1S Antibody (4H2)
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for MAP1S Antibody (H00055201-M05) (0)

There are no publications for MAP1S Antibody (H00055201-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP1S Antibody (H00055201-M05) (0)

There are no reviews for MAP1S Antibody (H00055201-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAP1S Antibody (H00055201-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional MAP1S Products

Bioinformatics Tool for MAP1S Antibody (H00055201-M05)

Discover related pathways, diseases and genes to MAP1S Antibody (H00055201-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP1S Antibody (H00055201-M05)

Discover more about diseases related to MAP1S Antibody (H00055201-M05).
 

Pathways for MAP1S Antibody (H00055201-M05)

View related products by pathway.

PTMs for MAP1S Antibody (H00055201-M05)

Learn more about PTMs related to MAP1S Antibody (H00055201-M05).

Blogs on MAP1S

There are no specific blogs for MAP1S, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP1S Antibody (4H2) and receive a gift card or discount.


Bioinformatics

Gene Symbol MAP1S
Entrez
Uniprot