MAMLD1 Antibody

Images

 
Western Blot: MAMLD1 Antibody [NBP1-84530] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: MAMLD1 Antibody [NBP1-84530] - Immunofluorescent staining of human cell line RH-30 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MAMLD1 Antibody [NBP1-84530] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAMLD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KRPCLEDVTLAMGPGAHPSTACAELQVPPLTINPSPAAMGVAGQSLLLENNPMNGNIMGSPFVVPQTTEVGLKGPTVPYYEKINSVPAVDQELQELLEELTKIQDPSPNELDLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAMLD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAMLD1 Protein (NBP1-84530PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAMLD1 Antibody

  • chromosome X open reading frame 6
  • CXorf6Protein CG1
  • F18CG1mastermind-like domain-containing protein 1
  • HYSP2
  • mastermind-like domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP1-88888
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2568
Species: Mu
Applications: WB, IHC
NBP2-14627
Species: Hu
Applications: IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-49881
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-80967
Species: Hu
Applications: ICC/IF, IHC, IHC-P, ICC
NB100-1414
Species: Hu
Applications: WB, PEP-ELISA
H00056899-P01
Species: Hu
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-47649
Species: Hu
Applications: WB, Flow, IHC-P, PAGE, IF
NBP1-84530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MAMLD1 Antibody (NBP1-84530) (0)

There are no publications for MAMLD1 Antibody (NBP1-84530).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAMLD1 Antibody (NBP1-84530) (0)

There are no reviews for MAMLD1 Antibody (NBP1-84530). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MAMLD1 Antibody (NBP1-84530) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAMLD1 Products

Bioinformatics Tool for MAMLD1 Antibody (NBP1-84530)

Discover related pathways, diseases and genes to MAMLD1 Antibody (NBP1-84530). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAMLD1 Antibody (NBP1-84530)

Discover more about diseases related to MAMLD1 Antibody (NBP1-84530).
 

Pathways for MAMLD1 Antibody (NBP1-84530)

View related products by pathway.

Blogs on MAMLD1

There are no specific blogs for MAMLD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAMLD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAMLD1