Recombinant Human MAGEA10 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MAGEA10 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 369 of Human MAGEA10 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPSSFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASLPLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQMKEPITKAEILESVIKNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHSFVLVTSLGLTYDGMLSDVQSMPKTGILILILSIIFIEGYCTPEEVIWEALNMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGPRAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
MAGEA10
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
67.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAGEA10 Protein

  • Cancer/testis antigen 1.10
  • CT1.10member 10
  • MAGE-10 antigen
  • melanoma antigen family A, 10
  • melanoma-associated antigen 10

Background

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-45719
Species: Hu
Applications: WB, IHC
NBP1-30151
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF1730
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
NBP1-76566
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-02509
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-41318
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, ICC, IF
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-31210
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85405
Species: Hu
Applications: IHC, IHC-P
NBP2-45722
Species: Hu
Applications: WB, IHC
H00004109-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MAGEA10 Recombinant Protein (H00004109-P01) (0)

There are no publications for MAGEA10 Recombinant Protein (H00004109-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEA10 Recombinant Protein (H00004109-P01) (0)

There are no reviews for MAGEA10 Recombinant Protein (H00004109-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGEA10 Recombinant Protein (H00004109-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAGEA10 Products

Bioinformatics Tool for MAGEA10 Recombinant Protein (H00004109-P01)

Discover related pathways, diseases and genes to MAGEA10 Recombinant Protein (H00004109-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGEA10 Recombinant Protein (H00004109-P01)

Discover more about diseases related to MAGEA10 Recombinant Protein (H00004109-P01).
 

Pathways for MAGEA10 Recombinant Protein (H00004109-P01)

View related products by pathway.

Blogs on MAGEA10

There are no specific blogs for MAGEA10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAGEA10 Antibody
NBP1-92095

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAGEA10 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEA10